KEGG   Candida albicans: CAALFM_C403180WAHelp
Entry
CAALFM_C403180WA  CDS       T00189                                 

Gene name
NCP1, CaO19.2672
Definition
(RefSeq) Ncp1p
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cal  Candida albicans
Brite
KEGG Orthology (KO) [BR:cal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CAALFM_C403180WA (NCP1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CAALFM_C403180WA (NCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 3637839
NCBI-ProteinID: XP_720425
UniProt: A0A1D8PLR7
Position
4
AA seq 680 aa AA seqDB search
MALDKLDLYVIVTLVVAVAAYFAKNQFLSKPQDTGFLSNDGAGGSSRNILETLKKNNKNT
LLLFGSQTGTAEDYANKLSRELHSRFGLNTMVADFADYDFDNFGDITDDILVFFIVATYG
EGEPTDNADEFHTWLTDEADTLSTLRFTVFGLGNSTYEFYNAIGRKFDQLLEEKGGERFA
EYGEGDDGTGTLDEDFLSWKDGVFDSLKNNLNYEEKELKYEPNVKLTERDDLTVDDSHVS
LGEPNKKYINSQGVDLSKGPFDHTHPYLAKITKTKELFNSKDRNCVHVEFDISDSNLKYS
TGDHLAVWPSNSDENIKQFLKCFGLEDKENTVIELKALDSTYSIPFPSPITYGAVIRHHL
EISGPISRQLFLSIAGFAPNEETKATLTRIGNDKQEFASTITRRKFNIADALLFASKGKA
WVDVPFEFIIENVQHLTPRYYSISSSSLSEKQLINITAVVEAEVESDGRAVTGVVTNLLK
NIEIEQNNTNETPVVHYDLNGPRNKFSKFKLPVHVRRSNFKLPKNTTTPVILIGPGTGVA
PLRGFVRERVQQVKNGVNVGKTILFYGCRNEHDDFLYKQEWSEYASVLGDKFEMFNAFSR
QDPSKKVYVQDKIVENYKIVNELLNNGATIYVCGDASRMARDVQAAIAKIVAKDRDISQE
SATELVKSWKVQNRYQEDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcattagacaaattagatttatacgttatcgtgacattagtggttgcagtagcagca
tactttgccaagaaccaattccttagcaaaccacaagacactggatttctttccaatgat
ggtgctggtggaagttcaagaaacatattggagacgttgaagaagaataataaaaacacg
ttattactatttggatcacaaactggtactgctgaagattatgccaataaattgtctcgt
gaattgcattccagatttgggttgaacaccatggttgccgattttgctgattatgatttt
gataattttggagatatcacagacgatatattggtgtttttcattgtcgctacttatggt
gaaggggaacctactgataacgccgacgaattccacacttggttaaccgatgaagctgat
actttgagtactttgagatttactgttttcggattaggtaactccacttatgagttttat
aacgccattggtagaaaatttgaccaattattggaagaaaaaggaggtgaaagatttgct
gaatatggtgaaggtgatgacggtactggtactttggacgaagatttcttatcttggaaa
gatggtgtttttgattcattgaagaataatttgaattacgaagaaaaagagttgaaatat
gaaccaaatgtcaaattgactgaacgtgacgatttaactgttgacgactctcatgtttcc
cttggtgaaccaaataaaaagtatattaactctcaaggcgttgatttaagcaaaggtcca
tttgatcacacacacccatatttagccaagataacgaaaacaaaggaattattcaattct
aaagatagaaattgtgtccatgttgaatttgatatttctgactccaacttgaaatacagc
actggtgatcatttagctgtttggccatctaattccgatgaaaatatcaaacaattcctt
aaatgttttggtttagaagacaaggaaaacaccgttatagaattgaaggcattagactcc
acttattccattccattcccaagcccaattacctatggtgctgttatcagacatcatttg
gaaatttctggaccaatttcgagacaattattcttatccattgccgggtttgcaccaaat
gaagagacaaaggctacattgactagaatcggtaacgataagcaagagtttgcttctaca
attacccgtagaaagtttaatattgccgatgcattgttgtttgcttccaaaggtaaagct
tgggtagatgttccatttgaatttattattgaaaatgttcaacatttgacacctcgttac
tactcgatttcttcttcatctttaagtgaaaaacaattgatcaatattactgctgttgtt
gaagctgaagttgaaagtgacggtagagctgttactggggttgttactaatttattgaaa
aacattgagattgaacaaaataacaccaacgaaaccccagtagttcattatgatttgaat
ggtccaagaaacaaatttagcaagtttaaattacctgttcacgttagaagatccaatttc
aaattaccaaagaatactactactcctgttattttgattggaccaggaactggtgttgct
ccattgagaggattcgttagagaaagagtccaacaagttaagaatggcgtgaatgttggt
aaaactattttattctatggttgcagaaacgaacatgatgatttcttgtataaacaagaa
tggtctgaatatgctagtgtattaggtgacaaatttgaaatgttcaatgccttttcaaga
caagatccatcgaagaaagtatatgtacaagataaaattgtggaaaattacaaaattgtt
aatgaattgttaaacaatggtgccactatctacgtttgtggtgatgccagtagaatggca
agagatgttcaagcagcaattgctaaaattgttgccaaagatagagatatctcacaagaa
agtgctactgaattggtcaaatcttggaaagtacaaaacagatatcaagaagatgtttgg
taa

DBGET integrated database retrieval system