KEGG   Candida albicans: CAALFM_C504650CAHelp
Entry
CAALFM_C504650CA  CDS       T00189                                 

Gene name
MSM1, CaO19.3950
Definition
(RefSeq) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cal  Candida albicans
Pathway
cal00450  Selenocompound metabolism
cal00970  Aminoacyl-tRNA biosynthesis
cal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CAALFM_C504650CA (MSM1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAALFM_C504650CA (MSM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cal01007]
    CAALFM_C504650CA (MSM1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cal03016]
    CAALFM_C504650CA (MSM1)
Enzymes [BR:cal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CAALFM_C504650CA (MSM1)
Amino acid related enzymes [BR:cal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CAALFM_C504650CA (MSM1)
Transfer RNA biogenesis [BR:cal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CAALFM_C504650CA (MSM1)
 Prokaryotic type
   Other AARSs
    CAALFM_C504650CA (MSM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 3636398
NCBI-ProteinID: XP_721859
UniProt: A0A1D8PP08
Position
5
AA seq 577 aa AA seqDB search
MRFKIRGPLIQLRYKSTKPFYITTPIFYVNAAPHIGHLYSMLIADTRNKWEKLNPSKESF
MLTGTDEHGLKIQSTAEKLGLEPKVLVDKVSQNFSKLAEQFDVNYDRFIRTTDNDHIELV
RYFWNLMMEKGFIYTDTHSGWYSISDETFFPETQIEEVVKNGKAVKISSETKNEVVYQKE
TNYFFKLSMFQEQLIQFLKQNPEFIKPKHRYQFILKELEDTKLPDLSISRPSSRLKWSIE
VPNDSTQKIYVWFDALLNYLTATKFPHGFEVQDSKFVTPENSIWPATHVIGKDIIRFHCI
YWPIFLMAAGIELPKQVIVHSHWLCDGFKMSKSLGNVVDPMEISEYYGVDPVRFFLVENS
NIDDDCKFSEELLQRSRDAVLGKYCNLISRIGGKNFSIEEAVKSSASGEFNNIREIIETY
TINKDSVEGLLSSSSKLTTDLNDLYNQMDHYFTNFDYIRAIQCWWSVINQANQIFQSAEP
WTYVKLINSPETPAELKEKYRILNNYFVYLCAETTRISSILIQPVMPQLSKKILDRLNVS
GRTSEFTTFGADLQYGSGANSKSHKVPLEKIAPRDIK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaaaatcaggggacctttaattcagcttagatataaatctacaaagccgttc
tatataactacacctatattttatgtcaatgcagcaccacatataggccacttgtattcc
atgttgatagcagatacaagaaacaaatgggagaaattaaatccactgaaagagtcattt
atgttgactggtacagatgaacatggtttgaaaatccaactgacggcggaaaagcttggg
ttggaacctaaggtattggttgataaagtatcccaaaacttttccaaattggcagaacaa
tttgatgttaattatgacagattcataagaaccacagataatgatcatattgagctagtt
cgttacttttggaacttgatgatggaaaaagggtttatttacactgatactcacagtgga
tggtattccatcagcgatgaaacatttttcccagaaacacaaatagaagaagtggtgaag
aatggaaaagcagtgaaaatatccagtgaaactaaaaatgaggttgtataccagaaggaa
actaattattttttcaagttgtcgatgttccaagaacaattgattcaatttttaaaacag
aatcctgaattcattaaaccaaaacatagatatcaatttattttgaaagaactagaggac
actaagttacctgatttgtcaatctcaagaccatcttcccgattgaaatggagtattgag
gtacctaacgacagcactcaaaagatttacgtttggttcgatgcgttgttaaactatttg
acggccacaaaatttccccacggttttgaggttcaagattcaaaatttgtcactcctgaa
aatagtatatggccagccactcatgtgataggaaaagacattatccgtttccattgcatc
tattggccaatatttttaatggcagctggtattgaattgccaaaacaagtgatagtgcac
tctcattggttgtgtgatgggttcaaaatgagcaaaagcttgggaaatgtggttgatcca
atggaaattagtgagtattatggtgtcgacccagtgcggtttttccttgttgaaaactca
aacatcgatgacgattgtaaatttagtgaagagttattacaaagatctagagatgctgtt
ttgggaaaatattgtaacttaatttcacgaattggcgggaaaaactttagcattgaagaa
gccgtgaaaagttcagcaagtggtgaatttaataacatacgtgaaataattgaaacctac
acaattaataaggattctgttgagggccttttatcttcttcaagcaaattgacaacagat
ttaaatgatttatataatcagatggatcattatttcacaaattttgactacattagagct
attcaatgctggtggtctgttattaatcaagccaaccaaatcttccagagtgcagagcca
tggacatacgttaagttaatcaactctcctgagacccccgctgaattaaaggaaaagtac
agaatccttaataactattttgtttacttatgtgctgagaccacgagaatatcatcaatt
ctcatacagccagttatgcctcagttgtcaaagaaaattcttgatagattaaatgtttct
ggacgtacatcagagtttactacatttggtgcagatttacaatatggctctggtgccaat
tccaagtcacataaagtccctctagaaaaaattgctccaagagatattaaatga

DBGET integrated database retrieval system