KEGG   Candida albicans: CAALFM_C600370CAHelp
Entry
CAALFM_C600370CA  CDS       T00189                                 

Gene name
NOP5, CaO19.1199
Definition
(RefSeq) RNA-processing protein
  KO
K14565  nucleolar protein 58
Organism
cal  Candida albicans
Pathway
cal03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cal00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CAALFM_C600370CA (NOP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cal03009]
    CAALFM_C600370CA (NOP5)
Ribosome biogenesis [BR:cal03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    CAALFM_C600370CA (NOP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 3646084
NCBI-ProteinID: XP_712316
UniProt: Q59S06
Position
6
AA seq 516 aa AA seqDB search
MAYVLTETAAGYALLKAADKKIHKSSSLVEDLNTAEKVAEQFKIHRFEKFQSAANALEEA
NAIIEGKVSENLQKLLEDAKSDKKATLIVSEAKLGNAINKLGLNFQVVSDAASLDLQRAI
KQFLPELLPGLDDSALKQMSLGLAHSMGRHKLKFSADKVDTMIIQAIALLDDLDKELNTY
AMRCKEWYGWHFPELAKMITDSAAYARIILTMGVRSNASETDLSEILPEEVEEQVKAAAE
VSMGTEITEDDLNNIKALAEQIVDFAAYREQLSNYLSSRMKAIAPNLTAMVGELVGARLI
AHAGSLTSLAKAPASTVQILGAEKALFRALKTKHDTPKYGIIYHASLVGQASGKNKGRIA
RTLAAKAAVSLRYDCFDEERDESDDFGLENRAKVEGRLSQLEGRDMRTTSKVVREQPKVE
ITEARAYNADADSTAAAAAAAPTADSDDEESETEEVEEKKSKKDKKKDKKEKKDKKKDKK
RKRDDDKEDKESSKKSKKDKKEKKEKKEKKAKKEKK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgttttaactgaaacagcagcaggatatgccttattgaaggcagctgataaa
aaaatccacaaatcttcttctttagttgaagacttgaacacagccgaaaaagttgctgaa
caattcaaaattcaccgttttgaaaaatttcagtcagcagcaaatgcattagaagaggct
aatgccattattgaaggtaaagtttcagaaaatttacaaaaattattagaagatgccaaa
tcagataaaaaggctactttgattgtctcagaagccaaattgggtaatgctatcaataaa
ttgggtttgaactttcaagttgtaagcgatgctgcatctttggatttacaaagagccatc
aaacaatttttgccagaattattacctggtttggatgattcagcattaaaacaaatgtct
ttgggtttagctcactctatgggtcgtcataaattaaaattctctgccgataaggtagac
accatgattattcaagctatagccttattggatgatttagataaagagttaaatacctat
gccatgagatgtaaggaatggtacggttggcatttcccagaattggccaaaatgattact
gattctgctgcatacgctagaattattttgaccatgggtgttagatctaatgcttctgaa
accgacttatctgaaatcttaccagaagaagttgaagaacaagtcaaagctgctgctgaa
gtgtctatggggactgaaatcactgaagatgatttgaataacataaaggcattggccgag
caaattgttgattttgctgcttacagagaacaattatccaattacttgtcttctcgtatg
aaagctatcgcaccaaatttgactgctatggttggagaattagtcggtgctagattgatt
gctcacgcaggttcattgacatcattagctaaagccccagcttcaactgtacaaattttg
ggtgccgaaaaggctttgttcagagctttgaaaaccaaacatgacacaccaaaatatggt
ataatctaccatgcttcattggttggtcaagccagtggtaaaaacaaaggtagaattgct
agaacattagctgctaaggctgctgtgtcattgagatacgattgttttgacgaagaaaga
gacgaatcagatgactttggtttagaaaacagagccaaggttgaaggtagattgagtcaa
ttggagggacgtgatatgagaaccacctctaaagttgtgagagaacaaccaaaagtggaa
ataaccgaagcccgtgcttataatgcagatgccgattctactgctgctgcagctgctgct
gccccaactgctgattcagacgacgaagagtccgagacagaagaagttgaagaaaagaaa
tctaagaaagataaaaagaaggataagaaagaaaagaaggataagaagaaggacaagaag
agaaagagagatgacgataaagaagataaagaatcttctaaaaaactgaagaaggacaaa
aaggaaaagaaagagaaaaaggaaaagaaagcaaagaaggaaaagaagtaa

DBGET integrated database retrieval system