KEGG   Candida albicans: CAALFM_CR04880WAHelp
Entry
CAALFM_CR04880WA  CDS       T00189                                 

Gene name
CaO19.6305
Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cal  Candida albicans
Pathway
cal00260  Glycine, serine and threonine metabolism
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
cal01130  Biosynthesis of antibiotics
cal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAALFM_CR04880WA (CaO19.6305)
Enzymes [BR:cal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CAALFM_CR04880WA (CaO19.6305)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 3647309
NCBI-ProteinID: XP_711090
UniProt: A0A1D8PSW2
Position
R
AA seq 369 aa AA seqDB search
MDFSTFDKQSPAHNDFRSDTFTTPTTSMIQSLAQTTLGDAVYNEDLKTIELEQKVAELTG
KEAGLYCVSGTLSNQIAIRTNLYQPPFSVLCDYRAHVYVHEAGGLSTLSQAMAQPINPKN
GIHLTLEDDILPNFIIDDGEIHGAPTKLICLENTLHGMIFPIEEIKKISKFCQQNNVKLH
LDGARIWNASAETGISLKEYCSYFDSVSLCLSKTLGAPIGTVLVSDKKFILKANHFKKQN
GGGIRQSGLLASMAIIAIDENFSKLKQTHIWAKELGKLCDENGIILEHPVQTNFVFIDIA
ANKINPEKLMEISDKYNVKIYSGRIAFHYQISQESFENAKKVVLEVIQYAKDHPYEEKTN
FKFYTSENK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggatttctctacttttgataaacaaagtccggctcataatgattttcgtagtgataca
ttcactactcccacaacatcaatgattcaatcattagctcaaaccacattaggcgatgct
gtatataatgaagatttaaaaaccattgaattagaacaaaaagtagctgaattaactggt
aaagaagcaggattatattgtgttagtggaacattatctaatcaaattgccattagaact
aatctttatcaaccaccttttagtgttttatgtgattatcgagcacacgtttatgttcat
gaagccggtggattatcgacattatctcaagctatggcacaaccaattaatcctaaaaat
gggattcatttaactttagaagacgatattctaccaaattttataattgatgatggggaa
attcatggtgctcctaccaaattaatatgtttagaaaatacattacatggaatgatattc
ccaattgaagaaattaaaaaaatttcgaaattttgtcaacaaaataatgttaaattacat
ttagatggtgcaagaatttggaatgcaagtgctgaaactggaatttcattaaaagaatat
tgttcatatttcgatagtgtatcactttgtttatcgaaaactttaggtgctcctataggt
acagttttagtaagtgataaaaaatttattcttaaagctaatcatttcaaaaaacaaaat
gggggtggcattagacaaagtggattattggcaagtatggcaattatcgccattgatgaa
aatttctcaaaattgaaacaaactcatatttgggctaaagaattgggtaaattatgtgat
gaaaatggaattattttggaacatccagtacaaacaaattttgtatttattgatattgct
gctaataaaattaatccagaaaaattgatggaaatttctgataaatataatgttaaaatt
tattctggtagaatagctttccattatcaaatatctcaagaatcatttgaaaatgctaaa
aaagttgttttagaagtgattcaatatgctaaagatcatccttatgaagagaaaactaat
tttaagttctatactagtgaaaataaatag

DBGET integrated database retrieval system