KEGG   Candida albicans: CAALFM_CR07420WAHelp
Entry
CAALFM_CR07420WA  CDS       T00189                                 

Gene name
KGD2, CaO19.6126
Definition
(RefSeq) alpha-ketoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cal  Candida albicans
Pathway
cal00020  Citrate cycle (TCA cycle)
cal00310  Lysine degradation
cal00380  Tryptophan metabolism
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
cal01130  Biosynthesis of antibiotics
cal01200  Carbon metabolism
Module
cal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAALFM_CR07420WA (KGD2)
  09105 Amino acid metabolism
   00310 Lysine degradation
    CAALFM_CR07420WA (KGD2)
   00380 Tryptophan metabolism
    CAALFM_CR07420WA (KGD2)
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAALFM_CR07420WA (KGD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H Biotin_lipoyl_2 YL1 RnfC_N RNA_pol_Rpc4 Presenilin CPSF100_C
Motif
Other DBs
NCBI-GeneID: 3646036
NCBI-ProteinID: XP_712333
UniProt: A0A1D8PTH3
Position
R
AA seq 441 aa AA seqDB search
MLSRSIKSSLKRTTALARPTAAKSALKIANASSVRSLHIKNTSSYRPTPFLTFQRYASVS
VKVPDMAESITEGTLAAFNKEVGDFVSQDETIATIETDKIDVEVNAPVSGTITEFLVDVD
ATVEVGQEIIKMEEGDAPAGGASASEAPAKKEEAPEKAKEESAPAAAPKKEETKKEEPKK
ESKPAPKKEESKKATQSTTSAPTFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTTF
NEVDMSNLMDFRKKYKDEFIEKTGIKLGFMGAFSKASALALKEIPAVNAAIENNDTLVFK
DYADISIAVATPKGLVTPVVRNAESLSILGIEKEISNLGKKARDGKLTLEDMTGGTFTIS
NGGVFGSLYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRVVDGREA
VIFLRTIKELIEDPRKMLLLE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaagatctattaaatcatcattgaagcgtactacagctttagccagaccaacc
gctgccaagtctgctttgaaaatcgccaatgccagttcagtgagatccctccatattaaa
aacacttcgagctatagaccaacaccattcttgactttccaaagatatgccagtgtttct
gtcaaagtgccagatatggctgaatctattaccgaaggtactttagccgccttcaacaaa
gaggttggggattttgtcagccaagacgaaacgattgccaccattgaaaccgataaaatc
gatgttgaagtcaatgctccagtgtcaggtactattactgaatttttagttgatgttgat
gccactgttgaagttggccaagaaatcattaagatggaagaaggtgacgccccagccggc
ggtgcatctgcatctgaagctccagctaagaaagaagaagcccccgaaaaggctaaagaa
gaatctgctccagctgccgcaccaaagaaggaagaaactaagaaagaggaaccaaagaag
gaatcaaaaccagcaccaaagaaagaagaatctaagaaggccacccaatctacaactagt
gctccaactttcaccaatttctccagaaacgaagagagagttaagatgaacagaatgaga
ttgagaattgctgaacgtcttaaggaatcacaaaacactgctgcttccttgaccactttc
aacgaagttgacatgtctaacttgatggatttcagaaagaaatacaaggacgaatttatt
gaaaagaccggtatcaagttaggattcatgggtgctttctccaaagcttctgccttggct
cttaaggaaatcccagctgtcaatgctgcaattgaaaacaatgacactttggtctttaaa
gattatgccgacatttcaattgctgttgccactccaaaaggtttggtgacccctgttgtc
agaaacgccgaatccttatctattttgggtattgaaaaggaaatctctaatttgggtaag
aaagccagagatggtaaattgactttggaagatatgaccggtggtactttcactatttct
aatggtggtgtttttggatcattatacggtaccccaattatcaatatgcctcaaactgcc
gtattaggtttacacggtgttaaagaaagaccagttactgttaacggacaaatcgtttct
agaccaatgatgtacttagcattgacttacgaccacagagtagttgacggtcgtgaagct
gttattttcttaagaaccatcaaggaattgattgaagatccaagaaagatgttgttgtta
gaataa

DBGET integrated database retrieval system