KEGG   Candida albicans: CAALFM_CR08090WAHelp
Entry
CAALFM_CR08090WA  CDS       T00189                                 

Gene name
SSB1, CaO19.6367
Definition
(RefSeq) Hsp70 family ATPase
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cal  Candida albicans
Pathway
cal03040  Spliceosome
cal04141  Protein processing in endoplasmic reticulum
cal04144  Endocytosis
cal04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CAALFM_CR08090WA (SSB1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CAALFM_CR08090WA (SSB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CAALFM_CR08090WA (SSB1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CAALFM_CR08090WA (SSB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cal01009]
    CAALFM_CR08090WA (SSB1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cal03041]
    CAALFM_CR08090WA (SSB1)
   03009 Ribosome biogenesis [BR:cal03009]
    CAALFM_CR08090WA (SSB1)
   03110 Chaperones and folding catalysts [BR:cal03110]
    CAALFM_CR08090WA (SSB1)
   04131 Membrane trafficking [BR:cal04131]
    CAALFM_CR08090WA (SSB1)
   03051 Proteasome [BR:cal03051]
    CAALFM_CR08090WA (SSB1)
   03029 Mitochondrial biogenesis [BR:cal03029]
    CAALFM_CR08090WA (SSB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cal04147]
    CAALFM_CR08090WA (SSB1)
Protein phosphatases and associated proteins [BR:cal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CAALFM_CR08090WA (SSB1)
Spliceosome [BR:cal03041]
 Complex B
  Other components
   Prp19 complex
    CAALFM_CR08090WA (SSB1)
 Complex C
   Prp19-CDC5 complex
    CAALFM_CR08090WA (SSB1)
Ribosome biogenesis [BR:cal03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CAALFM_CR08090WA (SSB1)
Chaperones and folding catalysts [BR:cal03110]
 Heat shock proteins
  HSP70 / DNAK
   CAALFM_CR08090WA (SSB1)
Membrane trafficking [BR:cal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CAALFM_CR08090WA (SSB1)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CAALFM_CR08090WA (SSB1)
Proteasome [BR:cal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CAALFM_CR08090WA (SSB1)
Mitochondrial biogenesis [BR:cal03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CAALFM_CR08090WA (SSB1)
Exosome [BR:cal04147]
 Exosomal proteins
  Proteins found in most exosomes
   CAALFM_CR08090WA (SSB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C ATP-synt_DE BcrAD_BadFG DDR
Motif
Other DBs
NCBI-GeneID: 3642095
NCBI-ProteinID: XP_716208
UniProt: Q5A397
Position
R
AA seq 613 aa AA seqDB search
MADGVFQGAIGIDLGTTYSCVATYDSAVEIIANEQGNRVTPSFVAFTSEERLIGDAAKNQ
AALNPKNTVFDAKRLIGRAFDDESVQKDIKSWPFKVVESNGQPLIEVEYLDETKTFSPQE
ISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNITGGVFTVKATAGDTHLGGQDFDTNL
LEHFKKEFQKKTGNDISGDARALRRLRTACERAKRSLSSGTQTTVEIDSLFDGEDFSANI
TRARFEDINSALFKSTLEPVEQVLKDAKISKSQVDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTNDDTKDLLLLDVIPLSLGVAMQGNVFAPVVPR
NTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCTENTLLGEFDLKNIPPMQAGEPVLEA
IFEVDANGILKVTAVEKSTGRSANITISNSIGRLSTEEIEKMISDAEKFKSSDDAFAKRH
EQKQKLEAYVASVESTVTDPVLSAKLKKSAKDKIEAALSDALQTLEIEESSADDYRKAEL
ALKRAVTKGMATR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggtgttttccaaggtgctattggtatcgatttaggtactacttactcatgt
gttgctacttatgattctgctgttgaaatcattgccaacgaacaaggtaacagagtcact
ccatcttttgtcgctttcactagtgaagaaagattgattggtgatgctgctaaaaatcaa
gctgctttgaacccaaagaacactgttttcgatgctaagcgtttgattggtagagctttc
gacgatgaatctgtccaaaaagatatcaagtcatggccattcaaagttgttgaatccaac
ggtcaaccattgattgaagttgaatacttggacgaaaccaaaactttctccccacaagaa
atttcctccatggtcttgaccaagatgaaggaaattgctgaagccaagatcggtaaaaaa
gttgaaaaagctgttgtcactgttccagcttatttcaatgatgctcaaagacaagccacc
aaagatgctggtgccattgccggtttaaacgttttgagaatcattaacgaaccaactgct
gccgccattgcttacggtttaggtgccggtaaatctgaaaaagaaagacacgtcttgatc
ttcgatttgggtggtggtactttcgatgtttccttattgaacattactggtggtgttttc
actgttaaagccactgctggtgacactcacttgggtggtcaagatttcgataccaacttg
ttggaacacttcaagaaggaattccaaaagaagaccggtaacgatatttctggcgatgct
agagctttaagaagattgagaactgcttgtgaaagagctaagagatctttgtcttctggt
acccaaaccactgttgaaatcgactccttgtttgatggtgaagatttctctgccaacatt
accagagccagatttgaagacatcaactctgctttgttcaaatctactttagaaccagtt
gaacaagttttgaaagatgctaaaatcagcaaatcccaagttgacgaagttgtcttggtt
ggtggttccaccagaattccaaaagtccaaaaattgttgtctgacttctttgacggtaaa
caattggaaaaatctattaacccagatgaagctgttgcttacggtgctgctgttcaaggt
gctatcttgaccggtcaatccactaacgatgacaccaaagacttgttattgttggatgtc
attccattgtctctcggtgttgctatgcaaggtaacgtttttgccccagttgtcccaaga
aacaccactgttccaaccatcaagagaagaactttcaccactgttgctgaccaccaaacc
actgttcaattcccagtttaccaaggtgaacgtgtcaactgtactgaaaacaccttgttg
ggtgaatttgacttgaaaaacatcccaccaatgcaagccggtgaaccagttttggaagcc
atttttgaagttgatgctaacggtatcttgaaggtcactgctgttgaaaaatccactggt
agatctgctaacatcaccatctccaactccattggtagattgtcaactgaagaaatcgaa
aaaatgatctctgatgctgaaaaattcaaatcatccgatgatgctttcgccaagagacac
gaacaaaaacaaaaattagaagcttacgttgcttccgttgaatctactgtcactgaccca
gtcttgtctgctaaattgaagaaatctgccaaggacaagatcgaagctgctttgtctgat
gctttgcaaactttggaaattgaagaatcttctgctgacgactacagaaaagctgaatta
gctttgaagagagctgtcaccaaaggtatggctacccgttaa

DBGET integrated database retrieval system