KEGG   Candida albicans: CAALFM_C105120WA
Entry
CAALFM_C105120WA  CDS       T00189                                 
Symbol
CaO19.4059
Name
(RefSeq) amino acid transporter
  KO
K12389  battenin
Organism
cal  Candida albicans
SSDB
Motif
Pfam: CLN3 MFS_1 Pet20 DUF4602
Other DBs
NCBI-GeneID: 3647667
NCBI-ProteinID: XP_710728
UniProt: Q59LX9
Position
1:1070515..1071795
AA seq 426 aa
MFIISETQRTFASFFIFGLLNNILYVIILSAAIDLVGPSTPKAIVLLADIIPSFSFKVAA
PFFIHAVPYIIRLWTLVALSATGMVLISLSPTNVISWKILGITLASLSSGLGEVSFLQLT
HYYEENSAIGGFSSGTGGAGLFGSFLFMVLTNVMGFPVWVVLLICAVFPSGFIITYFNLL
PLPMHEYQVILQQQQEREEEQEEEEYQQQLQDEARSQNIESIREVKYSVNYISKHVQNTI
HKITPLILPYMLPLTTVYISEYVINQGISPTLLFPLKEVPRWLISSYRDIYVVYGFLYQL
GVFISRSSVTMGIRIKRLYLLSVLQFINVMITLYQSIYDLPFHSIWWLFLLIFYEGLLGG
ASYVNTFKSVSEQVSRTKREFSMGCVSISDSLGIVTAGCINWWLELKLCHLQVARGRDWC
LKGGSL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtttataatctctgaaacacaacgaacatttgcttcatttttcatatttggattatta
aacaatattttgtatgtgattatcttatcagcagcaatagatcttgtgggaccatcaact
cctaaagcaattgtgttattagccgatatcatcccatcattttcttttaaagtggcagca
ccatttttcattcatgctgtaccttatattatacgattatggacattagtggcattgtca
gccacagggatggtattaatttcattgagtcccaccaatgtcattagttggaaaatcttg
ggaatcacattagcatcattatcttctgggttgggagaagttagttttttacaattgacc
cattattacgaagaaaattctgcaattggtgggttttcaagtgggaccggtggtgccgga
ttgtttgggagttttttgtttatggtattaactaatgtaatggggttcccagtgtgggtg
gtcttattgatttgtgcagtatttcccagtgggtttattattacttatttcaatttgttg
ccattgccaatgcatgaatatcaagtgatattacagcaacaacaggaacgggaggaagaa
caagaagaggaggaatatcaacaacaattacaagatgaagcaagatcccagaacattgaa
tcgatacgtgaggtgaaatattctgtgaattacattagtaaacacgttcaaaacacaata
cataaaatcactccgcttattttaccttatatgttaccattaaccacagtttatatatct
gaatacgtgatcaatcaaggtatctcaccaacgttgttattccccttgaaagaggtacca
cggtggttgatatcaagttatcgagatatttatgttgtctatgggtttttataccaattg
ggggttttcatttctcgatcatcagtgacaatgggaatcagaattaaaagattgtatttg
ttgtcggtattacagtttataaatgtaatgatcacactttatcaatctatatatgatttg
cctttccatctgatttggtggttatttttattaattttttatgaaggattgctaggtgga
gcaagttatgtaaacacttttaaatcggttagtgaacaggtttcaagaacaaaaagagaa
tttagtatgggatgtgttagtattagtgattccttgggtatagttactgctggatgtatc
aattggtggttggaattgaaattgtgtcatttacaagtggctcgaggaagagattggtgt
ctcaaagggggatcactataa

DBGET integrated database retrieval system