KEGG   Candida albicans: CAALFM_CR04490CAHelp
Entry
CAALFM_CR04490CA  CDS       T00189                                 

Gene name
CaO19.540
Definition
(RefSeq) hypothetical protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cal  Candida albicans
Pathway
cal00062  Fatty acid elongation
cal01100  Metabolic pathways
cal01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    CAALFM_CR04490CA (CaO19.540)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CAALFM_CR04490CA (CaO19.540)
Lipid biosynthesis proteins [BR:cal01004]
 Fatty acid synthase
  Component type
   CAALFM_CR04490CA (CaO19.540)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Lipase_2 DUF676 Abhydrolase_1 Hydrolase_4 FSH1
Motif
Other DBs
NCBI-GeneID: 3641013
NCBI-ProteinID: XP_717403
UniProt: Q5A6L4
Position
R
AA seq 316 aa AA seqDB search
MLLSNLFNVQQTILSLIPATNFDVSTSFPEPVLSTTDTYRPVVIWHGLGDNYNTSGIHKV
HEILDSMYPGIFVYAIRLDDNPSSDEQKSFFGDANKQIDEVCQQLRNITELSHGFDSIGF
SQGGVFMRGLIERCPLEVNNLITFGSPHLGVSELPLCKDRFDWLCKRRNALLKKQVWHDS
VQKRVIPAQYFRDPANIDQYLEHSNYLADINNERDEKNATYKENFSKLNKLVLVSFTEDT
TLVPKESSQFHDFDPEHKRSIPFLYTELYKNDYIGLKTLYEKNSVDFLSIEAEHMHIDED
FIKNIAQEYLGGKLCT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttattactgaatttattcaacgtccaacaaactatacttctgcttataccagcgaca
aattttgatgtgtccacaagtttcccagaacctgttttgtcgacaaccgatacttaccga
ccagtcgtaatttggcatggtttaggtgacaactataacacgtccggtatacataaagtc
catgaaatattagacagcatgtatccaggaatatttgtctatgcaatacgtttagatgat
aacccttcttccgatgaacaaaagtctttttttggggatgccaacaaacaaattgacgag
gtgtgccaacaacttcgaaatatcactgaattactgcatgggtttgattctattggattc
tctcaaggtggggtttttatgagaggtttgatagaaagatgccccttagaagtgaacaat
ttaataacttttggttctccgcatttgggagtgctggaactacctctatgcaaagaccgt
tttgattggttatgcaaacggagaaatgcattattgaagaagcaagtttggcacgatagt
gttcaaaagcgagttataccagcacagtattttagagatccagcaaacatagaccaatat
ttagagcattcaaattacttggcagatataaacaacgagcgcgatgaaaagaatgcaact
tacaaggaaaacttttcaaaattgaacaaattagtgttagtaagttttaccgaagatacc
actcttgtgcctaaagagagttcacagtttcatgattttgacccagagcacaagagaagt
atcccctttctttatacggaattatacaagaacgactacattggattaaaaaccctttac
gaaaagaattcagttgattttctatcgatcgaagcagaacatatgcatattgatgaggat
ttcataaaaaatattgctcaagagtatttaggtgggaaattatgtacgtaa

DBGET integrated database retrieval system