KEGG   Candida albicans: CAALFM_C307800CA
Entry
CAALFM_C307800CA  CDS       T00189                                 

Gene name
CaO19.6175
Definition
(RefSeq) hypothetical protein
Organism
cal  Candida albicans
SSDB
Motif
Pfam: Fcf2 AAA_21 HisK_sensor
Other DBs
NCBI-GeneID: 3647461
NCBI-ProteinID: XP_710931
UniProt: A0A1D8PL04
Position
3
AA seq 207 aa
MTEIPTIIETSETESFSERAHVPDDTASLDDLFADLKKESRSLPTVKDFKSIEKSIQSLP
RINANLETALQKKPIRIHDPVIPPKKKTTETSDERWFNMKQPEMTPEIKRDLQIIKQRSA
LDPKRHYKKDKWEIPKFFQMGTIIEGNTEFYSSRLKRKERGKTMVEELLHDDTTKKYFKR
KYHEIQQTKTSGRKGFYKKVKNARKKY
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacagaaataccaacaattatagaaacctctgaaactgaatcgttctcagaaagagcg
catgtacctgacgacactgcctcgctcgatgatttgtttgcagatttgaaaaaggaatca
cgatctctcccaaccgttaaagacttcaagtcaattgaaaagtccatacaaagcttgcct
agaataaatgccaacttagaaacagccctacaaaaaaaacctatcaggatccatgaccca
gtaataccaccgaaaaagaagactacagaaacgtctgatgaaagatggttcaatatgaaa
cagccagaaatgactcctgaaattaagagagatttacaaatcataaagcaaagaagtgct
ttagacccaaaaagacactataaaaaggataaatgggaaatcccgaaattcttccagatg
ggaacaatcatcgaaggtaataccgaattctactcctcgagattaaagagaaaagagcgt
ggtaaaactatggtcgaagagttgctacatgacgataccaccaagaaatacttcaagaga
aagtatcatgaaatacagcaaacaaaaaccagtggccgtaaaggtttttataaaaaggtt
aaaaatgctaggaaaaaatattaa

DBGET integrated database retrieval system