KEGG   Caloramator sp. E03: FDN13_03005
Entry
FDN13_03005       CDS       T05994                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cale  Caloramator sp. E03
Pathway
cale00472  D-Arginine and D-ornithine metabolism
cale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    FDN13_03005
Enzymes [BR:cale01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     FDN13_03005
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067 DUF1953
Other DBs
NCBI-ProteinID: QCX34769
UniProt: A0A5B7TPJ5
Position
complement(572101..572466)
AA seq 121 aa
MKRADDFEVRRQHLKDLTDEELEQRFWALAEKIVDPLVELARNNTTPSIERSILLRMGFS
SLEAKDIVNNTIDRGLMGKGAGHVVLKVSKHLNRDYREVGREMAQGLHWDLAVNIFKGGE
K
NT seq 366 nt   +upstreamnt  +downstreamnt
attaaaagagctgatgattttgaagttagaaggcagcatcttaaagatcttaccgatgaa
gaattagagcaaagattttgggctcttgctgaaaaaatagttgaccctttagttgaattg
gcaagaaacaatacaactccatcaattgaaaggtcaatccttttaaggatgggattttca
agccttgaagcaaaggatattgtaaataatactatagacagaggtcttatgggaaaagga
gcagggcatgttgttttaaaggtatcaaagcatcttaacagagattatagggaagttgga
cgggagatggcccagggacttcattgggacttagcagtaaacatttttaaaggaggtgaa
aagtaa

DBGET integrated database retrieval system