KEGG   Caloramator sp. E03: FDN13_04640Help
Entry
FDN13_04640       CDS       T05994                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
cale  Caloramator sp. E03
Pathway
cale00630  Glyoxylate and dicarboxylate metabolism
cale00660  C5-Branched dibasic acid metabolism
cale01100  Metabolic pathways
cale01120  Microbial metabolism in diverse environments
cale01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FDN13_04640
   00660 C5-Branched dibasic acid metabolism
    FDN13_04640
Enzymes [BR:cale01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     FDN13_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: QCX33054
UniProt: A0A5B7TIA6
Position
complement(910017..911285)
Genome map
AA seq 422 aa AA seqDB search
MKVVDVLCSAGRTGFFFDDQRAIKKGAVHDGFTYIGEPVTEGFKKIRVAGESISVMLILE
DGQIAYGDCAAVQYSGAGGRDPLFLAKDFIPIIEKHIAPMLIGRELKSFKDLAEEIDTML
VDGKRLHTAIRYGITQAILDGVAKSKKLTMAEVIRYEYNTGIEFKEVPIFTQSGDDRYNN
VDKMIIKGADVLPHGLINNVKEKLGERGELLREYVVWLRDRIMHLRTSEDYNPILHIDVY
GTIGIAFNNDIEKMVDYISELERAAYPLKLRIEGPMDVENREGQMMELKKLRKALKEKGI
GVEIVADEWCNTWEDIKYFTDEQAADMIQIKTPDLGGVNNIVEAILYCKKHGIGAYCGGT
CNETDRSAQVCTNIAIACGADQCLAKPGMGVDEGFMIVYNEMQRVLTLAKNRERINNALN
KS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagtagatgttttatgcagtgcaggaagaacgggttttttcttcgatgatcaa
agagctataaaaaaaggagcagttcatgatggatttacctatattggagagcctgtgact
gaaggatttaaaaaaataagggttgctggagagtcgatatctgtaatgttaatccttgag
gatggtcaaattgcttatggagattgtgcagcagttcagtattctggagcaggaggaagg
gatccgctatttcttgcaaaggattttattccaataatagaaaaacatatagctccaatg
cttataggaagagagcttaaaagctttaaagatttagcagaagaaatagatacaatgctt
gttgatggtaaaagacttcatacagcaataagatatggtattacccaggcaatactagat
ggtgttgcaaagtctaaaaagcttacaatggctgaggttataaggtatgaatacaataca
gggattgagttcaaggaagttccaatatttactcaatcaggagacgacaggtataataat
gttgacaagatgattataaagggagctgatgttttgccacacggccttataaacaatgtg
aaggaaaagcttggagagagaggagagcttttaagggagtatgttgtgtggctgagggat
agaataatgcaccttagaacatcagaggactataaccctattttgcatattgatgtatac
ggaactattggaatagcttttaacaatgatattgaaaagatggtagactacatttcagaa
cttgaaagggcagcctatccattaaagcttaggatagaagggcctatggatgtggaaaac
agggaaggacagatgatggagcttaaaaagcttagaaaggcactaaaagaaaagggtatt
ggtgttgaaattgttgcagatgaatggtgcaacacttgggaggatataaaatactttaca
gatgagcaggcagcggatatgatacagattaaaactcctgatcttggaggagtaaataat
atagttgaagctatattgtattgtaaaaaacacggcattggtgcttactgtgggggaacc
tgtaatgaaacggaccgctcagctcaggtttgcacgaatatagcaatagcctgtggcgct
gaccagtgtcttgcaaaaccaggaatgggtgttgatgaaggatttatgatagtttataat
gaaatgcaaagggttttgactcttgcaaaaaatagggagaggataaacaatgcattaaat
aaatcttag

DBGET integrated database retrieval system