KEGG   Caloramator sp. E03: FDN13_07930Help
Entry
FDN13_07930       CDS       T05994                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cale  Caloramator sp. E03
Pathway
cale00670  One carbon pool by folate
cale01100  Metabolic pathways
cale01120  Microbial metabolism in diverse environments
cale01200  Carbon metabolism
Module
cale_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cale00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    FDN13_07930
Enzymes [BR:cale01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     FDN13_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: QCX34818
UniProt: A0A5B7TMN1
Position
1597831..1599501
Genome map
AA seq 556 aa AA seqDB search
MPSDIEIAQKAKMKDIREIAKSAGILEDELELYGKYKAKVSLDIFKRLKDKKNGKLVLVT
AITPTPAGEGKSTTTVGLGQALNKIGKNAIIALREPSLGPVFGIKGGAAGGGYAQVVPME
DINLHFTGDMHAITSANNLLSAAIDNHIHQGNSLRIDSRQIIWKRVLDMNDRALRDVVIG
LGGKANGFVRQDGFMITVASEIMAILCLSEDLMDLKRRIGKIIIGYNFDGEPVTAKDLKV
DGAMTLLLKDAIKPNLVQTLENTPALIHGGPFANIAHGCNSLIATKLGLKLADYLITEAG
FGADLGAEKFLNIKCRYGGLNPSAVVIVATIRALKMHGGVKKTDLNIENLEALDKGFANL
SKQVENIKKFGIPVMVAVNRFSADTESEVELLIRKCKEYGVEVALNEVWEKGGEGGIEMA
EKLVDLLDREQSNYKPLYDIEKSIPEKIETIVKEIYGGEGADFSPKALKEIKKLEELGLD
KMPVCMAKTQYSLSDNPQLLGAPKGFRITVNDVRISAGAGFIVCQTGDIMTMPGLPKVPA
AENIDIDENGVVTGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgccaagtgatattgaaatagcacaaaaagctaaaatgaaggatattagggaaattgca
aaatctgccgggatacttgaagatgagcttgaattatatggaaaatacaaagcaaaagtt
tccttagatatttttaaaagattaaaggataaaaagaacggaaagcttgtgcttgttacg
gctataactccaacaccagcaggagagggaaaatcaactacaactgtaggtcttggacaa
gcactaaataagattggtaagaatgcaataatagcattaagagaaccttctttaggccct
gtatttggaattaaaggaggggcagcaggaggaggatatgctcaagttgtacctatggaa
gatattaatctccactttacaggggatatgcatgcaataacctctgcaaacaacctacta
tcagcagctatagataatcacatccatcagggaaacagtcttagaatagattccaggcaa
attatatggaaaagagttttagacatgaacgatagagcattaagggatgttgtaattggc
cttggggggaaagcaaacggttttgtaaggcaggatggctttatgataactgttgcttct
gagattatggcaatactttgcttatcggaagatcttatggatttaaaaagaaggataggc
aaaataataattggatataatttcgatggcgaacctgtaactgcaaaggatttgaaggtt
gacggtgctatgactcttcttttaaaggatgcaataaagcctaatcttgttcaaactctt
gaaaatactcctgcacttattcatggaggtccctttgcaaacattgcccatggatgtaat
agcttgattgcaacaaaacttggattgaaacttgcagattatttaattactgaagcaggt
tttggtgcagatcttggtgctgaaaaattccttaatataaaatgtaggtatgggggatta
aatccatcagctgtggttatcgttgcaacaattagggctttaaagatgcatggaggagtt
aaaaagactgatcttaatatagaaaaccttgaagctcttgataaaggttttgcaaatctt
tcaaaacaggttgaaaacataaagaagtttggaatccctgttatggttgcagttaataga
ttttctgctgatacagaatctgaagtagaactattaattagaaaatgtaaagaatatggc
gtggaggttgctcttaatgaagtatgggaaaaaggtggagaaggcggaatagaaatggct
gagaaacttgtagacctattagatagggaacaatcaaattataaacctctatatgacatt
gaaaaatccataccagaaaagatagaaacaatcgttaaagaaatatatggaggagaggga
gctgacttctcaccaaaagcattaaaggaaataaaaaaacttgaggaacttggacttgac
aaaatgcctgtatgtatggcaaaaactcagtattccttatctgacaaccctcagctttta
ggggctccaaagggttttaggattactgtaaatgatgttagaatatcagctggtgctggt
tttatagtatgccagacaggtgatataatgacaatgccgggacttccaaaagttccagca
gctgaaaacatagatatagatgagaatggagttgtaacaggactgttttaa

DBGET integrated database retrieval system