KEGG   Calothrix sp. 336/3: IJ00_15720Help
Entry
IJ00_15720        CDS       T03937                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00520  Amino sugar and nucleotide sugar metabolism
calh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    IJ00_15720
Enzymes [BR:calh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     IJ00_15720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-ProteinID: AKG22526
UniProt: A0A0T7BTX2
Position
3750710..3751642
Genome map
AA seq 310 aa AA seqDB search
MRILVTGGAGFLGSHLIDRLMTAGHEVICLDNFYTGHKRNILKWMDNPYFELIRHDITEP
IRLEVDQIYHLACPASPVHYQYNPVKTVKTNVMGTLNMLGLAKRVKARFFLASTSEVYGD
PDIHPQVEEYRGNVNPIGLRACYDEGKRIAETLTFDYYRQNKVDVRVVRIFNTYGPRMLE
NDGRVVSNFIVQALRGEPLTVYGDGSQTRSFCYASDLIEGFIRLMNSDYVGPVNIGNPGE
YTILELAQAVQKLVNPDSPINYEPLPADDPRRRRPDITKAKTLLNWEPTVPLEEGLKLTI
EDFRDRMKVS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttagtgacgggtggcgctgggtttcttggctcccatctcattgaccgacta
atgaccgcaggacatgaagttatatgtttagataatttctatacaggtcataagcgtaat
attctcaagtggatggataatccatactttgagttaattcgtcatgatatcactgagcca
attcgtttggaagttgaccagatatatcacctagcttgtcccgcctctcctgtccattat
cagtataatcccgtaaaaactgtcaagaccaatgtgatgggaaccttgaatatgttggga
ttagccaagcgagtcaaggcaagatttttccttgcttctacgagtgaggtatatggagat
cctgatattcacccccaagttgaagaatacagaggtaatgtcaaccccatcggtttacgt
gcctgctatgacgaaggtaagcggattgctgaaaccttaacctttgactattacagacag
aataaagttgatgtgcgcgtcgtccgtattttcaacacctacggacccagaatgttagaa
aacgatggtcgcgttgtcagtaatttcatcgtccaagctcttcgaggtgaacccttaact
gtatacggagatggttcccaaacacggagtttttgctatgcatcagacctgattgaaggg
tttatccgtctgatgaatagtgattatgtaggacctgtaaatattggtaatcctggggaa
tacacgattttagagttagcccaagctgtacagaagctggtaaatcctgattctcccatt
aattatgaacctctcccggcagatgatcctcgtcgccgtcgtcccgatattactaaagcc
aagacattgttaaattgggaacctaccgttcctttggaagaggggttaaaactgacaata
gaagacttccgcgatcgcatgaaagtttcctag

DBGET integrated database retrieval system