KEGG   Calothrix sp. PCC 7507: Cal7507_0637Help
Entry
Cal7507_0637      CDS       T02358                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00860  Porphyrin and chlorophyll metabolism
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cal7507_0637
Enzymes [BR:calo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cal7507_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 DUF815 AAA AAA_28 AAA_18 ABC_tran tRNA_lig_kinase AAA_30 AAA_27 MMR_HSR1 AAA_7 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFY31126
UniProt: K9PDT0
Position
complement(676884..678008)
Genome map
AA seq 374 aa AA seqDB search
MSPTAQTTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIPVVANDPFNSDPSDPDVMSDEVRQLLEQGAEIPVAHKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRAEFDQNP
LVFVDKSKPEQEALQQQIVNAQTLLPEVKSDYDVRVKISEICSELDVDGLRGDIVTNRAA
KALTAFEGRTEVTVDDVRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFGVELPEKDT
AQKNGTGQLKTGVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcctactgctcaaaccacagcgagtgcgcgacgtgtggtattcccgtttacagca
attgtgggtcaggaagaaatgaaactggcgctgctgttgaacgtgattgaccccaaaatt
ggcggtgtgatgattatgggcgatcgcggtactggcaaatccaccactatccgggccctg
gccgacctgttacccgaaatccctgtggtagctaacgaccccttcaacagcgaccccagc
gatcccgatgtcatgagtgacgaagtccgccaattgttagaacaaggggcagaaattccc
gttgctcacaaaaaagtccagatggtagacttgccattaggcgctacagaagatcgggtt
tgcggcactatcgacatcgaaaaagctttatctgaaggtgtgaaggcttttgagccggga
ctgttagccaaagctaaccggggtatcctctacgttgatgaagtcaacttgcttgatgac
cacttggtagatgttttactcgactccgcagccagtggttggaacaccgtagaacgggaa
ggtatttctatccgtcacccagcacgttttgtactggtgggttctggaaacccagaagaa
ggtgaactacgcccccaactcctcgaccgctttggaatgcacgccgaaatccacacagtc
aaagaaccagccttaagggtgcaaattgtcgaacaacgagcagaatttgaccaaaatccc
ttggtgtttgtagacaagtctaaacctgagcaagaagcactacaacagcagattgtcaat
gctcaaacactgttacccgaagtgaaaagtgattatgatgtgcgggtgaaaatttcggaa
atctgttcagaattggatgtggatggtttacggggtgatatagtgacaaaccgcgccgcc
aaagcattgacagcatttgaaggacgcaccgaagtcacagttgatgatgtccgccgcgtg
atcactctatgtctgcgtcaccgactgcggaaagacccgttggagtcgattgactctggc
tacaaagtagaaaaagcttttgcacgggtctttggtgtggaactaccagaaaaggatact
gcacaaaaaaacggtacaggtcaactgaaaactggagttaggtaa

DBGET integrated database retrieval system