KEGG   Calothrix sp. PCC 7507: Cal7507_0641Help
Entry
Cal7507_0641      CDS       T02358                                 

Definition
(GenBank) Photosystem Q(B) protein
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00195  Photosynthesis
calo01100  Metabolic pathways
Module
calo_M00161  Photosystem II
calo_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Cal7507_0641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:calo00194]
    Cal7507_0641
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     Cal7507_0641
Photosynthesis proteins [BR:calo00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    Cal7507_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: AFY31130
UniProt: K9PCL6
Position
680087..681169
Genome map
AA seq 360 aa AA seqDB search
MTATLQQRQSANVWDQFANWITSTNNRLYIGWFGVLMIPTLIAATACFVIAFIAAPPVDI
DGIREPVAGSLLYGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL
IGVFCYLGREWELSYRLGMRPWISVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESLNYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFLLAAWPVVGIWFTALGVSTMAFNLNGF
NFNQSVIDSQGRVIATWADVINRANLGMEVMHERNAHNFPLDLAAGDVAPVALTAPAING
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccttacaacagcgccaaagcgccaacgtatgggaccagtttgccaactgg
atcaccagcaccaataatcgcctttacattggttggttcggcgtcttaatgatccccacc
ctcatagctgccactgcttgcttcgtaattgcctttatcgccgcacctcccgtagacatt
gatggtattcgtgaacccgttgcaggttccttgctctacggaaacaacatcatatccggt
gcagtaattccttcttcaaatgccatcggcttgcacttctaccccatttgggaagcagct
tctttagatgagtggttgtacaacggcggaccttaccaactagtaattttccacttcttg
attggtgtattttgctacctcggacgtgagtgggaactttcctaccgcttaggaatgcgt
ccttggatttcagttgcatacagcgcacctgttgcagcagcaaccgcagtattcttgatt
tacccaattggtcaaggttcattctccgatggtatgcccttgggtatctccggcacattc
aactttatgctcgtgttccaagcagaacacaacatcttgatgcaccccttccacatgttg
ggagtagcaggtgtgttcggtggttcattgttctctgcaatgcacggttctttggtaaca
tcttccttagttcgtgaaaccaccgaaaccgaatccttgaactacggttacaagttcgga
caagaagaagaaacctacaacatcgttgcagcccacggctacttcggtcgcctaatcttc
caatacgcatcattcaacaacagccgttcactgcacttcttgctcgcagcatggccagta
gttggtatctggttcacagctttgggtgtcagcacaatggcgttcaacttgaacggattc
aacttcaaccaatcagtgattgattctcaaggtcgcgtcatcgctacttgggctgatgtg
atcaaccgcgctaacctgggtatggaagtaatgcacgagcgtaacgctcacaacttcccc
ctagatttggctgctggtgatgttgctcctgtggctctgactgctcctgctatcaacggt
taa

DBGET integrated database retrieval system