KEGG   Calothrix sp. PCC 7507: Cal7507_0735Help
Entry
Cal7507_0735      CDS       T02358                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
calo  Calothrix sp. PCC 7507
Brite
KEGG Orthology (KO) [BR:calo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cal7507_0735
Enzymes [BR:calo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Cal7507_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AFY31223
UniProt: K9PDI3
Position
complement(782203..783015)
Genome map
AA seq 270 aa AA seqDB search
MKSYLAAAIQLTSVPDLHKNLAQAEELIDLAVRRGAELVSLPENFSFMGEEEDKLAQGDA
IARESEIFLKKMAQRFQVTILGGSFPVPVGDTGKAYNTTILIDPNGQEIARYQKVHLFDV
NVPDGNTYRESSTVMAGQQLPPVYFSEKFGNLGLSICYDVRFPELYRHLSDKLADVLFVP
AAFTAFTGKDHWQILLQARAIENTCYVIAAAQTGNNYARRQTHGHAMIIDPWGVILADAG
EQPGIAIAEIKPSRLEQVRRQMPSLQHRVF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtatttagccgccgctattcaattgacaagtgtgccagatctacacaaaaac
ttggcacaggcagaagaattaattgatctcgccgtgcgtcgaggtgctgagttggtgagt
ttgccagaaaatttttcctttatgggagaggaagaagacaaacttgcccaaggagatgcg
atcgcccgcgaaagtgaaatatttctcaaaaaaatggctcaacgctttcaagttactatc
ttgggcggcagctttccagtccctgttggcgacacaggcaaagcttataatacaactata
ctaattgaccccaacggtcaggaaattgctcgctaccaaaaagtacatctatttgatgtg
aatgttcctgatggtaacacctatcgagaatccagcacggtgatggctggacagcaacta
cctcccgtatatttctcagaaaaattcggtaatctgggactttctatttgctatgatgtc
cgtttcccagaactttaccgacatctatcagataagctagctgatgttttgtttgttcca
gctgcctttactgccttcactggcaaagaccactggcaaatattactacaagcaagagct
attgaaaatacctgttatgtgattgcggccgcccaaactggtaataattatgcccgtcgc
caaacccacggacacgccatgattatcgacccttggggggtaattctcgccgatgctggc
gaacaaccaggaattgcgatcgcagaaatcaaaccctctcgtctagaacaagtccgccgt
caaatgccctccctgcaacatcgggtattttaa

DBGET integrated database retrieval system