KEGG   Calothrix sp. PCC 7507: Cal7507_4560Help
Entry
Cal7507_4560      CDS       T02358                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00030  Pentose phosphate pathway
calo00480  Glutathione metabolism
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01120  Microbial metabolism in diverse environments
calo01130  Biosynthesis of antibiotics
calo01200  Carbon metabolism
Module
calo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
calo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cal7507_4560
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cal7507_4560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:calo04147]
    Cal7507_4560
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cal7507_4560
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cal7507_4560
Exosome [BR:calo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cal7507_4560
  Exosomal proteins of colorectal cancer cells
   Cal7507_4560
  Exosomal proteins of bladder cancer cells
   Cal7507_4560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AFY34927
UniProt: K9PQV4
Position
5165110..5166639
Genome map
AA seq 509 aa AA seqDB search
MVSLLENPLRVGLQQQGMPEPQIIVIFGASGDLTWRKLVPALYKLRRERRIPPETTIVGV
ARRAWSHEYFREQMQKGMEEAHANVELGELWQDFSRGLFYCPGDIDNPESYQQLRTLLTE
LDEKRGTRGNRMFYLSVAPSFFPEAIKQLGSAGMLDDPYKHRLVIEKPFGRDLASAQSLN
QVVQKFCKENQVYRIDHYLGKETVQNLLVFRFANAIFEPLWNRQFVDHVQITVAETVGVE
DRAGYYESAGALRDMLQNHLMQLYCLTAMEVPNSMDADSIRTEKVKALQATRLADVHNLS
RSAVRGQYSAGWMKGQPVPGYHEEPGVNPSSTTPTYVAMKFLVDNWRWKGVPFYLRTGKR
MPKKVSEISIHFRDVPSRLFQSAAQQANANILAMRIQPNEGISLRFDVKMPGAEFRTRSV
DMDFSYGSFGIQATSDAYDRLFLDCMMGDQTLFTRADEVEAAWQVVTPALSVWDAPADHT
TIPRYEAGTWEPAEAEFLINQDGRRWRRL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtctgctagaaaacccgttgcgcgttggtctgcaacagcaagggatgcccgaa
ccccagattatagttatctttggcgcttctggtgatcttacctggcgcaaactagtgcca
gcactttacaaattgcgccgggaacgacgcattcccccagaaaccaccattgttggtgta
gcacgtcgggcatggagccatgaatacttccgtgagcaaatgcaaaagggcatggaagag
gctcatgctaatgtcgaactaggggaactctggcaggacttttcacgaggtttgttctac
tgtcctggggatatagacaaccctgaaagctatcagcaactcagaaccctgttgactgaa
ttagacgaaaaacgcggcacacggggaaaccgcatgttttacctctccgtggctccatca
ttctttcctgaagccattaaacagctgggatcagcagggatgttagacgatccttataaa
catcgtctagtcattgaaaaaccttttggtcgggacttggcttctgcccaaagcctcaac
caagtggtgcaaaaattttgtaaagagaaccaagtatatcgcattgaccactacttaggc
aaagagacagtccagaatttgctggtgtttcgctttgccaatgcgatttttgaacccttg
tggaatcgtcagtttgttgaccacgttcaaattaccgtggcagaaaccgtgggagtggaa
gaccgagcgggatattatgaaagcgccggcgcattgcgggatatgttgcaaaatcactta
atgcaactttattgcttaaccgcaatggaagtacctaattcaatggatgccgatagtatc
cgtacggaaaaagttaaggcattacaagctacacgtctagctgatgtccataatttgtca
cgttcagcagtacgcggccagtacagtgctggctggatgaaaggtcaaccagtacctggg
tatcatgaagaaccaggagtcaatcccagttccaccacacccacctatgtggcgatgaag
tttcttgtggacaactggcgctggaaaggagtccccttttacctgcgtaccggaaagcgg
atgccaaaaaaagtcagtgaaatttccatccacttccgcgatgtgccttctaggttgttc
caatcggcagcacaacaagccaacgccaacattttagcaatgcggattcaaccgaatgaa
ggaatttccctgcgttttgatgtgaaaatgcctggggcagaattccgcacccgttccgtt
gacatggattttagttatggttcctttggtatccaagcaacttccgacgcctacgatcgc
ctattccttgattgtatgatgggcgatcaaacattattcacacgggcagacgaagtagaa
gcagcttggcaggtagtgacaccagccctttccgtgtgggatgcacccgccgaccataca
accattccccggtacgaagccggtacttgggaaccagccgaagcagaattcttgattaac
caagacggtcgccgctggcgcagactgtag

DBGET integrated database retrieval system