KEGG   Calothrix sp. PCC 7507: Cal7507_4995
Entry
Cal7507_4995      CDS       T02358                                 

Definition
(GenBank) Tetratricopeptide TPR_2 repeat-containing protein
Organism
calo  Calothrix sp. PCC 7507
SSDB
Motif
Pfam: TPR_11 TPR_2 TPR_1 TPR_16 Rubredoxin
Other DBs
NCBI-ProteinID: AFY35345
UniProt: K9PPM2
Position
complement(5668060..5668473)
AA seq 137 aa
MKCPVCGAVYRPTKGSRETGKDEELVSISTSSPSPTCRRCKADLSDLFHIHDHAIWYHRQ
ALHLLSQKLYPEAATYNNQALVLYYSNADFHTLAGKLSALQGEWREAILSWQQALKFDPQ
NAIASNCLQMIELMTRN
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaatgtcctgtttgtggtgcagtttatcgtccaacaaagggcagcagagaaacaggg
aaagatgaagaactagtatcaatatccacctcatccccctccccaacttgcagacgctgc
aaagcagacttatctgacttgttccatattcatgaccatgccatctggtatcacagacaa
gcactgcatttattgtcgcaaaaactttatccagaagcagcaacatacaacaatcaagct
ctagttttatattacagcaatgcagacttccataccttggctgggaaattatcggcattg
caaggagaatggagagaagcaatcttatcttggcaacaagcactcaagtttgatccacaa
aatgccattgcttctaattgtctacaaatgattgagctaatgacacgcaattaa

DBGET integrated database retrieval system