KEGG   Calothrix sp. PCC 6303: Cal6303_0087Help
Entry
Cal6303_0087      CDS       T02372                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00250  Alanine, aspartate and glutamate metabolism
calt00330  Arginine and proline metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
calt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cal6303_0087
   00330 Arginine and proline metabolism
    Cal6303_0087
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:calt03000]
    Cal6303_0087
Enzymes [BR:calt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Cal6303_0087
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Cal6303_0087
Transcription factors [BR:calt03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Cal6303_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N LuxC
Motif
Other DBs
NCBI-ProteinID: AFY99195
UniProt: K9UUF6
Position
100688..103660
Genome map
AA seq 990 aa AA seqDB search
MVLEAKINTYEAKTQEIAKQLLAATQDNRSFLANLRDQMRLDDKLLDWAMSNPGLRVQLF
RFIDALPALRSKPEIAAHLQEYLGDESVELPAALKGMLNFASPDSVPGQVAATTVSTATE
TLAHKYISGENIKQVLKTIERLRKDKMAFTVDLLGEAVITETEAQSYLDRYIDLMQQLSE
AAKNWSTVSLIDEADGQPIPKVQVSVKLTAFYSQFDPLDAIGSEIKVSDRIRILLRRAKE
LGAAVHFDMEQYAYKDLTFSILKKILLEDEFIQRTDIGMTVQAYLRDSAKDARDLIDWAK
KRGNPISIRLVKGAYWDQETIKAQQKHWSQPVYNDKVATDANFETITQLLLENHQYIYAA
IGSHNVRSQAHAIAIAETLAVPRRSFEMQVLYGMGDKLAKALVSKGYRVRVYCPYGDLLP
GMAYLIRRLLENTANSSFLRQNLENRPIEELLAAPNPQGDSTYHPSTTGFPGAVDTDFAE
AAKRQESGDAFKQVRQQLGKTYLPLINGEYVETAEIIDSVNPSNFSEVIGKIGQISVEQA
ETAMKAAKTAFLKWRKTPVRERAGVLRKAAEIMEQRRAELCAWIVLEVGKPVREADGEVS
EAIDFCRYYADEMERLDEGYNYDIAGETNRYTYQPRGIVVVISPWNFPYAIACGMVVAGL
VTGNSTLLKPAETSSVIAAKLTEILVAAGIPQGVFQYVPGRGSVVGSYLVNHPETHVIAF
TGSQEVGCKIYADAAILKPGQKHMKRVIAEMGGKNGIIVDESADLDQAVLGTVQSAFGYS
GQKCSACSRVIVVESVYETFVERFVEATKSLNIGFAESPSTQVGPVIDGKSQSRIREYIE
KGKAEAKIALEMPAPENGYYVGPVIFRDVPADGIIAQQEIFGPVVAVIKAKNFQEALEIA
NSTNYALTGGLYSRTPSHIQQAQAEFEVGNLYINRTITGAIVSRQPFGGFKLSGVGSKAG
GPDYLLQFLEPKTITENIQRQGFAPIEGAE
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
gtggtattagaagcaaaaatcaacacttacgaagccaaaacccaggagatagctaaacaa
cttcttgcagctacccaggacaatcgctcatttttggcgaatttacgcgatcagatgcgc
ttggatgataaattgctagattgggcaatgagtaatcctggtttgcgtgttcagctattt
aggtttattgatgctttgcctgcactacgcagtaaaccggaaattgccgcacatcttcag
gaatatctgggggatgagtcggtggagttgcctgctgctttgaaggggatgctaaatttt
gcaagtcctgattcggtaccaggacaggttgccgcaactacagtatccacagccacagaa
actctagcacacaaatatatttccggggaaaatattaagcaggtattaaagacaattgaa
cggttgcggaaggataaaatggctttcaccgtagatttactaggtgaggctgtaattaca
gaaactgaagcccaatcttatttagatcgttatatagacttgatgcagcagttgagtgag
gctgcaaaaaactggtctacagtatcattaattgatgaggcagatggacagccgataccc
aaggttcaggtttccgtaaaactgacggcattttattcccagtttgatcctttggacgca
attgggagcgaaatcaaagtcagcgatcgcattcgtattctactacgccgtgcgaaggag
ttgggtgctgctgtccattttgatatggaacaatatgcctataaggatttaacttttagt
atcctgaaaaaaatcctgttggaggatgaatttattcagcgtaccgatattgggatgact
gtacaagcttatctgcgtgatagtgcaaaagatgcacgggatttaatcgattgggcaaaa
aaacgcggcaatcccatttctatccgcttggtaaaaggtgcatattgggatcaagaaacc
atcaaagcacagcaaaaacattggagtcaacctgtttacaacgataaggttgccactgat
gccaactttgagaccattacccaactattattagaaaatcatcaatatatatatgctgcc
atcggtagtcataatgttagatcccaagcacatgcgatcgcaatcgcggaaactttggct
gttcctcgtcggagttttgagatgcaggttctctacgggatgggggataagttagcgaaa
gccttggtaagtaaaggttatcgggtgcgggtatattgtccttacggggatttattaccg
gggatggcttatctgattcgccgtttgttggaaaataccgccaatagttcctttttacgg
caaaatttggaaaatcgtccaattgaggaactgcttgcagcaccaaacccccaaggagat
tccacatatcacccttccacaacaggtttccctggtgcggtagataccgactttgccgaa
gcagcaaaacgtcaagagtcaggagatgcatttaaacaggtacgtcagcaacttggtaaa
acctatcttcccctaattaatggggaatacgtggaaaccgccgaaattatcgactcagtg
aacccctccaacttcagcgaagtgatcggcaaaattggacaaatttccgtcgaacaagcg
gaaacagccatgaaagccgcaaaaactgcctttttaaagtggcgaaaaacacccgtgaga
gaacgtgccggggtgttacggaaagccgccgaaatcatggaacaacgccgtgctgaactt
tgcgcctggatagtcctggaggtcggtaaacccgtgcgggaggctgatggtgaagtttct
gaagctatcgacttttgtcgctactacgccgatgaaatggagcgattagacgaaggttac
aattatgacattgccggagaaaccaaccgttacacctatcaacctcgcggcatagtagtg
gtgatttcaccgtggaatttcccttatgcgatcgcatgtgggatggtagtggcaggattg
gtgactggtaactccaccctcctcaaaccagcggaaacatcctcagtaattgcggcaaaa
ctaacggaaattttggtagcagcggggattccccaaggtgtattccaatatgttcctggt
agaggttcggtagttggttcttacttagttaatcatcccgaaactcatgtgattgctttt
actggttctcaagaagtcggctgtaagatttacgcagatgccgccatcttgaaacctggt
cagaaacacatgaaacgggttattgccgagatgggtgggaaaaacggcatcatcgtcgat
gaaagtgccgatttagaccaagcagtattgggtacagtacaatcagcatttggttacagc
ggacaaaaatgttctgcatgttcccgcgtcattgtggtggaatcggtatatgaaaccttc
gtagaacgatttgtagaagccacaaaatccctaaatatcggctttgccgagtcacctagt
acccaagttggacccgtcattgatggtaaatcccaatcccgcatccgcgaatatatcgaa
aaagggaaagcagaagcaaaaatcgctttggaaatgcctgcacccgaaaacggctactat
gttggacccgtcatatttagggatgtccccgcagatggaattattgcccagcaggaaatt
ttcggtcctgtggttgccgtcatcaaagcgaagaacttccaggaagctttggaaattgcc
aacagcacaaactacgctttaacaggtggattatattcccgcaccccctcccacatccaa
caagcacaggcagaatttgaagtgggcaacctgtacattaaccgcacaattaccggggca
attgtatcccgtcaacccttcggtggtttcaaactatcgggagttggctctaaagctgga
ggtcccgactacctactacaatttttggaaccaaaaacaatcacagaaaatatccaacgt
caaggttttgcgccaattgaaggggctgagtaa

DBGET integrated database retrieval system