KEGG   Calothrix sp. PCC 6303: Cal6303_0722Help
Entry
Cal6303_0722      CDS       T02372                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
calt  Calothrix sp. PCC 6303
Brite
KEGG Orthology (KO) [BR:calt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:calt03016]
    Cal6303_0722
Enzymes [BR:calt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Cal6303_0722
Transfer RNA biogenesis [BR:calt03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Cal6303_0722
 Prokaryotic type
    Cal6303_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB-C_2 TruB_C_2 DKCLD
Motif
Other DBs
NCBI-ProteinID: AFY99791
UniProt: K9UX97
Position
complement(851510..852568)
Genome map
AA seq 352 aa AA seqDB search
MELKKAVGGGYPHFKTPLLSSSFFNRGECQFGSIFLRFDRIAAQLQYLQDIISQCFLFIV
QGFLNLDKPFGWTSHDCVAKVRKLLRMKKVGHAGTLDPAATGVLPIALGKATRLLQYLPG
DKAYKATIRFGVRTTTDDLEGEVISSQAVTGLNLEQIEAELGQFVGRIEQIPPSYSAIQV
DGKRLYDLARQGVAVEAPMRTVVVSQIDILDWREGEYPELDLSIACGAGTYIRAIARDLG
EALNIGGTLAGLQRTVSSGFSLDDSITITTLEAQVTDGSFVATLSDAPLEYLPSRTLAAN
DAKCWCQGQKIICEEQLLGENLRIYNENGIFLGVSKYLDGLLTPAMVFEPIS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtggaattaaagaaggcagtaggtggagggtatccccatttcaaaaccccccttctttct
tcttccttcttcaaccgtggggaatgtcaatttggtagtatttttctgagatttgatcgt
attgcagcccaattgcagtatcttcaagatattatctctcaatgcttcttattcatcgtg
caaggctttctcaatctcgacaaaccatttggttggacttctcacgactgtgttgctaaa
gtccgaaaactgcttagaatgaaaaaagttggacatgcaggaactctagatcccgcggca
actggagtattaccgattgcgttggggaaagcaacaagattgttacagtatcttcctggt
gataaggcttataaagcaactattcggtttggtgtacgcacaacaactgatgatttggaa
ggggaagtaattagttctcaagctgtgacagggttgaatttagagcaaattgaggctgag
ttgggtcaatttgttggtaggattgagcagataccacctagttatagtgcgattcaagtt
gatggtaaacggctttatgatttagcacgtcaaggtgtagcagtagaagcaccgatgcga
acagttgtggtatctcaaattgatatcttggattggcgtgaaggtgaatatccagaatta
gatctgagtatagcctgtggtgcgggtacttacattcgtgcgatcgcgcgtgacttggga
gaggctttaaatattggtggtacattagcaggattacagcggactgtaagtagcggtttt
agtttggatgacagtatcactattacaactttagaagcacaggtaacagatgggagtttt
gtagctaccctctccgatgcacctttagaatatcttccatcccgaactttggctgcaaat
gacgcaaaatgctggtgtcagggacaaaaaattatttgtgaagagcaattgttaggtgaa
aatttgagaatttataatgaaaatggtatttttctcggtgttagtaaatatttagatggt
ttactgactccagcaatggtttttgaacccatttcttag

DBGET integrated database retrieval system