KEGG   Calothrix sp. PCC 6303: Cal6303_0876
Entry
Cal6303_0876      CDS       T02372                                 

Definition
(GenBank) Cytochrome c-550
  KO
K02720  photosystem II cytochrome c550
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Cal6303_0876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:calt00194]
    Cal6303_0876
Photosynthesis proteins [BR:calt00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    Cal6303_0876
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrom_C Cytochrome_CBB3
Other DBs
NCBI-ProteinID: AFY99940
UniProt: K9UWJ2
Position
complement(1027938..1028429)
AA seq 163 aa
MLKRLIGICVATVLLAFQLFISSANAVELDAATRTVKLNASGDTTVLNLKQVKEGKRLFQ
FACAQCHAGGVTKTNQNVGLEPEALALATPPRNNIDSLVDYMKNPTTYDGEEEISEFHPS
TKSADIFTEMRNLTDEDLKAIAGHILMQPKIVGTKWGGGKIYY
NT seq 492 nt   +upstreamnt  +downstreamnt
atgttaaaaagattgattggaatctgcgtagcgactgtgctgctagcttttcaacttttt
attagtagtgcgaatgcagtagaactcgatgcagctactcgcactgtaaaattgaatgca
agtggcgacactaccgtgcttaatctcaagcaagttaaggaaggtaagcgtttatttcag
tttgcctgcgctcaatgtcatgctggtggtgtcactaaaaccaaccaaaacgttggatta
gaaccagaagctttggcattagctacacctcctcgcaataatattgacagtttagttgat
tacatgaaaaatcccaccacttatgatggggaagaggagatttctgagttccaccccagt
acaaaaagtgcggatattttcaccgaaatgcgtaacctcactgatgaggatctaaaagcg
atcgctggtcatattctaatgcaacctaagattgtaggaaccaagtggggcggtggtaaa
atttactactaa

DBGET integrated database retrieval system