KEGG   Calothrix sp. PCC 6303: Cal6303_3520Help
Entry
Cal6303_3520      CDS       T02372                                 

Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00860  Porphyrin and chlorophyll metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cal6303_3520
Enzymes [BR:calt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Cal6303_3520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25 AAA_26
Motif
Other DBs
NCBI-ProteinID: AFZ02452
UniProt: K9V4T7
Position
complement(4177296..4178162)
Genome map
AA seq 288 aa AA seqDB search
MKLAVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQE
KDYHYEDVWSEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVIL
FDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGN
RTVKRDLIDKYIESVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIA
DQILARPEGVVPNDSPDRELFTLLSDFYLNPRKPQVPNPEEELDLMIV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactagctgtttatggaaaaggtggtatcggtaaatccacaactagctgtaatatc
tcagtagctttggcaagacggggtaagaaagttttgcaaattggttgcgatcctaagcac
gacagcacctttactttgactgggtttttgattccgacaattattgatacgctccaagaa
aaagactatcactacgaagatgtttggtctgaagacgtaatttacaaaggttatggtggt
gttgattgtgtagaagcgggtggtcctcctgctggtgccgggtgtggtggttatgtagtt
ggtgagaccgtaaaattacttaaagagctaaatgcttttgatgagtacgatgtaatttta
tttgatgtccttggtgacgttgtatgtggtggttttgcagctccattaaattatgctgac
tactgtatgatcgttaccgataacggctttgatgctttgtttgctgcaaatcgtatcgcc
gcatcagtacgggagaaagcgagaactcaccctctgcgtctagctggtttaattggcaac
cgtaccgtcaagcgcgatttaatcgacaaatatattgaatcagtaccaatgccagtttta
gaggttttacctttaattgaagacatccgtgtttcccgcgtcaaaggtaaaactttgttt
gaaatggctgagtcggatccttctctgaactacgtttgcgactattatctcaacattgct
gaccaaattttggcgcgtccagaaggtgtagttcccaatgattcaccagatcgggaatta
tttactttgttatctgatttttacttaaatccgcgtaaaccacaggttcctaatccggaa
gaggaattagacttgatgattgtataa

DBGET integrated database retrieval system