KEGG   Calothrix sp. PCC 6303: Cal6303_4332Help
Entry
Cal6303_4332      CDS       T02372                                 

Definition
(GenBank) MCP methyltransferase, CheR-type with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt02020  Two-component system
calt02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:calt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cal6303_4332
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cal6303_4332
Enzymes [BR:calt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Cal6303_4332
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cal6303_4332
Two-component system [BR:calt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cal6303_4332
Bacterial motility proteins [BR:calt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cal6303_4332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR PAS PAS_4 CheR_N PAS_9 PAS_8 WEMBL Spc7 Fez1 DUF3584 PAS_7 OmpH DUF1664 HMMR_N IncA PAS_10 Exonuc_VII_L Methyltransf_12 Golgin_A5 CENP-K TelA APG6 DUF3450 KASH_CCD HOOK AAA_11 Methyltransf_31 PAS_3 DUF4407 Syntaxin-6_N HemX IFT57 Tropomyosin UPF0449 Laminin_II TMPIT AIP3 DUF4201 Methyltransf_25 COG2 TPR_MLP1_2 LMBR1 Mnd1 Sec8_exocyst FH2 Filament DUF5089 Fusion_gly FapA HAUS-augmin3 EzrA TSNAXIP1_N GAS Atg14 APG17 DUF724 AAA_13 TBPIP CALCOCO1 HIP1_clath_bdg MscS_porin AAA_32 DUF4795 Reo_sigmaC Mod_r TMF_TATA_bd ZapB DUF3540 Fmp27_WPPW DUF3552 DUF812 MCPsignal Uds1 Lebercilin Transglut_core2 V_ATPase_I ATG16 Jnk-SapK_ap_N ERM RasGAP_C MAP70 DUF3080 MPS2 zf-C4H2 Bap31 Prominin FPP
Motif
Other DBs
NCBI-ProteinID: AFZ03239
UniProt: K9V6A4
Position
complement(5203833..5205677)
Genome map
AA seq 614 aa AA seqDB search
MGNEEDKVFETLLDYLKWTRGFDFSGYKRSTLQRRIRKQMQSREIESFGDYLDYLEVHPE
EFIELLNTILINVTGFFRDASAWDYLRNQLIPQIISNKAANEPIRVWSAGCASGEEAYTL
AMILAEALGASEFRQRVKIYATDVDEDALTHARSASYTKQAIKSVPVELQEKYFEPMGNR
QVFRVDLRRVVIFGRHDLMQDAPISRLDLLVCRNTLMYFNADAQARMLSRFHFALNPTGF
LFLGKAEMLLTHSNLFTPLSLQHRIFAKVPKVHIRDRLLGLGQTGDEEASNLVAMHMQLR
EAALNSMPIAQLVIDCTGNLAIANLAARLMFGITLQNIGSPLRDLEISYRPVELRSRIEQ
IYSDRHTIIISDVVRNLPDGSIQYLDVQLTPLQENGENLLGVGIAFKDVTNYHNLQTELQ
RVTQELETANEELQSSNEELETTNEELQSTNEELETTNEELQSTNEELETMNEELHSTNE
ELQTINDELRERTQELNQINAFLQSILASIQAGVVVIDPQFNILSWNQETENLWGLRTEE
VKGQSFFNLDIGLPVGELREAIRTCLAGKNHIQLDIDATNRRGRSFRCRVTCNPLIGTTG
ERQGVILVMEEAES
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaagaagataaggtatttgaaacactgttagattacttaaaatggacaaga
ggttttgatttttcaggttataaacgctctactttacagcgacgcatccgtaaacaaatg
cagtcgcgggaaattgaatcttttggggattatttggattatttggaagttcacccagaa
gagtttattgagcttttaaatacaattttaattaatgtcactggtttttttcgtgatgct
tccgcttgggattatcttcgcaatcagttaataccccaaattatcagtaacaaagcagca
aatgaaccaattcgggtgtggagtgctggttgtgcttcgggagaagaagcttatacccta
gcaatgattttggcagaagctttgggagctagtgagtttcgtcaacgagttaaaatatat
gcgactgatgtggatgaagatgctttaacccatgctcgttctgctagttataccaagcaa
gcgattaaatctgttcctgtagagttgcaagaaaaatattttgaaccgatgggaaatcgg
caagtatttcgggtagatttgcgtcgagtggtaatttttggtcgtcatgacttaatgcaa
gatgctcccatttcccgcttagatttgttggtatgtcgtaacaccttaatgtacttcaat
gccgatgctcaagcaagaatgttgtcacggtttcattttgccctcaatcctacaggtttt
ttatttttggggaaagcagagatgttgcttacccacagtaatttatttacacctttgagt
ttacaacatcgcatctttgccaaagtacctaaggtacatatacgcgatcgcttacttggt
ttagggcaaactggtgatgaggaagctagtaatcttgttgctatgcatatgcagttgcgg
gaagctgccctaaattccatgcccattgcccaattagtgatagattgtactgggaactta
gcgatcgctaatttagcagcaaggttaatgtttggtatcactctccaaaatattggcagt
cccctgcgagatttagaaatttcctaccgtcccgtcgaattgcgatcacgtattgaacaa
atatatagtgatcgtcataccataattatttctgatgtggttcgcaacctccccgatggc
agtatccaatatttggatgtgcaactcacacccctacaggaaaatggcgaaaatttgctc
ggagtgggaattgcctttaaagatgtcaccaactaccacaacctgcaaacggaattgcaa
cgggtaactcaagaactggaaactgctaacgaagaattgcaatctagtaacgaagaacta
gaaacaactaacgaggaattgcaatccaccaacgaagaactagaaaccaccaacgaggaa
ttacaatctaccaacgaagaactagaaacaatgaacgaagaactccactccaccaacgaa
gaattacaaacaattaatgatgagttgcgagagcgtacccaggaactcaaccaaatcaat
gctttcctccaatccatcctcgccagcattcaagctggggtagttgtaattgacccccaa
tttaacatcctcagttggaatcaagaaactgaaaacctttggggattaagaaccgaagaa
gtcaaaggacaatcattttttaatttggatattggtttacctgtgggggaactacgggag
gcaatccgaacttgtcttgctgggaagaatcacatacagttggacatagatgccaccaat
cgtcggggtcgaagttttcgctgtcgagtcacctgcaatcccctaattggcaccacagga
gagcggcagggggttatcctcgttatggaggaagcagaatcatga

DBGET integrated database retrieval system