KEGG   Cicer arietinum (chickpea): 101488780Help
Entry
101488780         CDS       T02819                                 

Definition
(RefSeq) erlin-2-B
  KO
K23341  erlin
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cam04121]
    101488780
Ubiquitin system [BR:cam04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101488780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 101488780
NCBI-ProteinID: XP_004505361
UniProt: A0A1S2YIN5
Position
Ca6
AA seq 360 aa AA seqDB search
MDSQQQTRASQQPRDSNSSTSIAIPFLSFIAIAALVLVPSASPSFKNTLSIIHQVPEGHV
GVYWIGGALLKTITEPGFHMKMPFLTQFEPVQVTLQTDEVTDIPCGTKGGVMISFGKIEV
VNRLRKESVYETLLNYGVHYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMKDA
LQVDCTRYAPGIEIIGVRVTKPNIPESIRRNFEQMEEERTKVLIAIEKQKVAEKEAETMK
KMAISEAEKNANVSKIVMEQKLLEKDSARKQEEIENEMYLAREKSLADADFYRVIREAEA
NKLKLTPEFLELKFIESIANNTKIFFGDKIPNMILDQRLLGNFLAEEVSRGAGTKMKADI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggattcgcagcaacaaactcgagcatcgcaacaaccccgtgattccaattcttcaact
tccattgcaattcccttcctctctttcatcgccattgccgctttggttttggttccttca
gcatcaccgtccttcaaaaatacgctgtcaattattcaccaagtccctgaaggccatgtg
ggggtatattggataggaggtgcgcttctgaaaacaattacagagccaggtttccatatg
aagatgccattcttaactcaatttgagcctgttcaagtgacacttcaaacagatgaggtg
acagatataccgtgtggtactaaaggaggtgttatgatcagttttgggaagattgaggtt
gttaacagactgcgtaaggaatctgtctatgagacattgctcaactatggtgtacattat
gacaagacatggatatatgacaagattcatcatgaaattaatcagttttgcagctctcat
agtcttcaacaagtatatatcgatgtgtttgatcagattgacgaaaaaatgaaggatgcc
cttcaagttgactgtacccgctatgctccgggcattgagatcattggtgtccgtgtcaca
aagccaaatattccagaaagcataagacgcaactttgaacaaatggaagaagagcgtact
aaggtcttaattgccattgagaaacagaaagttgctgagaaggaggcagagactatgaag
aagatggctattagtgaggctgagaagaacgccaatgttagcaagatcgttatggaacag
aagttgttggaaaaggatagtgctagaaaacaggaagaaattgaaaatgaaatgtatcta
gcacgtgaaaagagcctggcagatgcagatttctaccgtgtaataagggaagctgaagca
aacaagttgaagcttacccctgagtttcttgagctaaaatttatcgaatccatcgctaat
aatacaaagattttctttggagacaagattccaaatatgattttggaccaaaggctgctc
ggaaacttccttgcagaagaagtttcaagaggggccggtacaaaaatgaaagcagatata
taa

DBGET integrated database retrieval system