KEGG   Cicer arietinum (chickpea): 101489604Help
Entry
101489604         CDS       T02819                                 

Definition
(RefSeq) protein HASTY 1
  KO
K14289  exportin-5
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101489604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cam03016]
    101489604
   03036 Chromosome and associated proteins [BR:cam03036]
    101489604
Transfer RNA biogenesis [BR:cam03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    101489604
Chromosome and associated proteins [BR:cam03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     101489604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 101489604
NCBI-ProteinID: XP_004494659
UniProt: A0A1S2XVQ0
Position
Ca3
AA seq 1203 aa AA seqDB search
MENSGSSSNDNNNTMIVNNVAQAISTALNWASTTDARQSALSFLDSMKAGGDIRTLANTL
FVLVKKNWSSEIRLHALKMLQHLVRLRWEELSPEEHKNFANLSIDLMSEIADPCEDWALK
SQTAALVAEIVRREGLDLWQEMFPSLVSLSSKGPIQAELVSMMLRWLPEDITVHNEDLEG
DRRRLLLRRLTQSLPEILPLLYTLLERHFTAALNEAGRKQIDTAKMHAATVTATLNAVNA
YAEWAPLTDLAKSGIINGCGFLLSAPDFRLHASEFFKLVSSRKRSVDASVSEIDQVMRDI
FQKLMNISGEFLYRSGSNPGSVDEGEYEFAECICESMVSLGNFNLQSIAGDSAILPLYLE
QMLGFFKNYKFAIHFQSLQFWMVLLRDLLSKPKISTHSAADSSAISGSGSGEAENSKKKT
LSFVNDDFIGAMLDTSFPRMLKRDKILPATVLSLGALELWSDDFEDKGKFGQYRSRLLEL
IKFVASYKPLIAAAKVSEKIDTIIKSFLLSPAPTQDLAVMESMQLALENVVNAVFDRSND
IAKANAEVQFALCRTFEGLLQQFISLKWTEPALVEVLVHYLDAMGPFLKYFPDAAGSVIN
KLFELLTSLPLEKDTSTSSARHARLQTCTSFIRIAKAADQSILPHMKGIADTMSCLQREG
RLLQGEHNLIGEAFLIMASSAGIQQQQEVLTWLLEPFSLQWTQLEWQDTYLSSPHGLVQL
CSEAPVMWSIFHTVTFFERALKRSGVKKAHVNLENSSTSDSTPLNPMASHISWMLNPLLK
LLRVVHSLWSPSISQALPGEIKAAMAMSDVERFSLLGEENPKLSKNPKEGYGEATESDIR
NWIKGIRDSGYNVLGLSTTIGDSFFKTLDVHSVAVAIMENIQSMEFRHLRQVVHSILIPL
VKHCPLDMRELWLEKLLHPLFVHVQQALSCSWSSLLQDGRAKVPDIHGILSGSDLKVEVM
EETLLRDLTREMCSLLSVIASPPLNTGIPSFEQSGHVIRYDMSSVKSLDTVASCSLVGFL
LKHEGLALPILRMCLEVFTWTDGEAVTKISPFCSAMVALSIVTNHKELIEYVSRDLFTSV
IQGLALESNAIISSDLVAICREIFVYLCDRHPAPRQVLSSLPFITPHDLLAFEESLTKTS
SPKEQKQHMKSLLLLATGNKLKALAAQKSVNIITNVSMRPRSSANAPESNVHDGEVIGLA
AII
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtggcagcagcagcaatgacaacaacaacactatgattgttaacaatgtc
gctcaagccatatccaccgctctcaactgggcttccactaccgatgctcgtcaatccgct
ctctcttttctcgattccatgaaggcaggtggtgatatacggacattagcgaacacattg
ttcgttttggtgaaaaagaattggtcatctgaaatccggttgcatgctcttaagatgctg
cagcatttggtgaggttaaggtgggaggaattaagcccggaagagcacaagaattttgca
aatctctccattgatttaatgtctgagattgcggatccttgtgaagattgggctcttaaa
agtcagactgctgcccttgttgccgagatagttagaagagaaggtcttgatctatggcaa
gaaatgtttccatcgctggtttctctatccagcaagggtccaatacaagctgagttggtt
tcaatgatgctgcggtggcttcctgaggacattacagttcacaatgaggacttagaaggt
gaccgccgaaggctacttttgcgtaggctaacccaatcattgcctgaaattttgccacta
ttatacactttacttgaaagacactttacagctgcattaaatgaagctggtagaaaacag
attgacactgcaaaaatgcatgcagctacagtaacagctactttaaatgcagtaaatgca
tatgctgagtgggctccattgactgatcttgcgaagtctggtatcattaatggttgtggc
ttcctactatctgctcccgactttcgtcttcatgcttctgagtttttcaaacttgtttca
tcgaggaagagatctgttgatgcgtctgtttctgagattgaccaagttatgagggatatc
tttcaaaaattgatgaatatatctggagagtttttgtacagatctggttcaaatcctggt
tctgtagatgagggtgaatatgaatttgctgaatgcatatgtgaaagtatggtgtcactg
ggtaactttaacttgcaaagtattgctggagatagtgccatacttccactctacctagaa
cagatgctgggatttttcaaaaattacaagtttgcaattcattttcaatccctgcaattc
tggatggtgctactgagggatttattgtcaaagccaaaaatttccactcactcagctgct
gacagttcagctattagtggctcaggttctggagaggctgaaaattcaaagaagaagact
ctgagctttgtgaatgatgattttattggtgctatgttggatacatctttccctcgcatg
ctcaaaagagataaaattctgcctgcaactgtactttctttaggggcattggagttgtgg
agtgacgattttgaggacaagggtaaatttggccagtatcgttctaggctgttggagctg
attaaatttgttgcttcgtacaaacccctgatagctgctgccaaagtttctgaaaaaatt
gatacaataatcaagagtttcttgctttccccagcaccaactcaggacttagctgtgatg
gaaagcatgcagttggctttagagaatgttgtaaatgcagtttttgatagatccaatgat
attgccaaggcgaatgctgaagttcagtttgcattatgtagaacatttgaaggtttactg
caacaatttatttccttgaaatggacggagcctgcacttgtggaagtacttgttcactat
ttggatgcaatgggtccctttttgaagtatttcccggatgcagctggcagtgttatcaat
aaactatttgaacttctaacatccctcccccttgaaaaggacacgtcaacgtcaagtgct
cggcatgctagattgcagacctgtacatcctttattcggatagcaaaagctgctgaccag
agcatcttgcctcatatgaagggcattgctgataccatgtcttgtttgcaaagggaaggt
cgtttgcttcagggagagcataatcttatcggcgaagcttttcttataatggcttcttct
gctgggattcaacagcagcaagaagttttaacgtggttactagaaccttttagcctacag
tggacacaattggagtggcaggatacatacttgtctagtccacatggtttggttcagttg
tgctcggaagcaccagttatgtggtcaatttttcacacagttacattctttgagagggca
cttaagaggagtggggtgaagaaagctcacgtgaatttagagaacagctcaacatcagat
tccactcctttaaatccaatggcctctcatatatcatggatgctaaatcctctcttgaaa
ctacttcgagttgtacattctctttggtctccatctataagtcaagctttacctggagag
atcaaagctgcaatggccatgagtgatgttgaaaggttcagtcttcttggagaagagaac
cctaaattgtcaaagaaccctaaggaaggatatggtgaagcaactgagtcagatatacga
aattggattaaaggcatcagagacagtgggtataatgtattgggtttgtcaacaaccatt
ggggattcgtttttcaaaactttggatgtgcactctgttgctgttgccatcatggagaat
atacagtcaatggagttcaggcatttgaggcaggttgttcattccattttgattcctttg
gttaaacattgtcctctggatatgcgggagctttggcttgaaaagcttctgcacccatta
tttgttcatgttcagcaagctcttagctgttcatggtctagtcttctgcaagatggtagg
gcaaaggttcctgatattcatggcattcttagtggatcagaccttaaagtagaagtgatg
gaggaaacacttttgagggatctcacacgtgagatgtgttcgctcctctctgtgattgct
tctcctcccctcaatactggaatcccttctttcgaacagtctgggcatgttattcgttat
gacatgtcttctgtgaaaagcttggatacagttgcatcatgctctttggttggtttcctt
ctaaagcatgaaggtcttgcccttccaatattaagaatgtgtttagaagtttttacatgg
acggatggtgaagctgtgacaaagatttctcctttttgctctgcaatggtagctctttcg
atagtaacaaaccataaagaactcatagaatatgtttctagagatctttttacgtctgtt
attcaaggtttagcccttgaatcaaatgcaataatcagttctgatctagttgccatttgc
cgagaaatatttgtatatctttgtgatagacacccagcccccagacaggttttgtcgtct
cttccctttattacccctcatgatttactcgcctttgaggaatctttaacgaaaacatcc
agtccaaaggaacaaaagcagcacatgaaaagcttgcttctgttggcaactggtaacaaa
ttaaaagcacttgcagcacagaaaagtgtaaacatcattacaaatgtttctatgagacca
cgcagctcagccaatgctcccgagtccaatgttcatgatggggaagttatagggttggca
gccattatctga

DBGET integrated database retrieval system