KEGG   Cicer arietinum (chickpea): 101490153Help
Entry
101490153         CDS       T02819                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00052  Galactose metabolism
cam00500  Starch and sucrose metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101490153
   00500 Starch and sucrose metabolism
    101490153
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101490153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 101490153
NCBI-ProteinID: XP_004515737
UniProt: A0A1S2Z628
Position
Un
AA seq 658 aa AA seqDB search
MSNNSPYTPLLNGAHNNRGNRNNLLLILTGLLLLASLIAFSGYRASNVTVPHAHVSSSST
ISHETTKPITVPAASSRGVSAGVSEKSNMFLSAGVSEKSNMFLSAAGNKVGETESFPWNN
TMLSWQRTAFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVWGDIVWGHAVSRDMIH
WLHLPLAMVADEWYDKNGVWTGSATILSDGQIVMLYTGSTNESVQVQNLAYPADPSDPLL
VDWIKYPSNPVLFPPPGILSKDFRDPTTAWLTAEGKWRITIGSKINKTGVALVYDTVDFK
TYERKQGLLNAVPGTGMWECVDFFPVSKKSENGLDTSFNGDEVKHVMKVSLDDDRHDYYA
LGIYDEKKVKFVADDLKNDVGIGLRYDYGIFYASKTFYDEKKHRRVLWGWIGESDSEYAD
VAKGWASVQSIPRIVKLDKKTGSNLLQWPVAEVESLRLKSNEFKNLKAKPGTVMSLDIET
ATQLDILAEFEIDKEALEKTAHTNLEYECSISGGASQRGALGPFGLLVLADDGLSEYTPV
YFYVVKGSNGNLKTSFCSDQSRSSQANDVHKQIFGSVVPVLKGEKLSLRILVDHSIVESF
AQGGRTCVTSRVYPTRAIYGAARLFLFNNATEATVTASLKIWQMNSAFIHPFRPDQKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaactctccctacactcctcttctcaatggggcccacaataaccgtggaaac
cgtaacaaccttcttctcatccttaccggcttacttttactcgcttcgttaatcgccttt
agcggctaccgagcctccaacgtaactgtccctcatgctcacgtctcatcgtcatccaca
atatctcatgaaacaaccaaacctatcacggtgcctgctgcttcgtcgcgcggtgtttcc
gccggtgtgtcggagaagtcaaacatgtttctctccgccggtgtgtcggagaagtcaaac
atgtttctctccgccgccggtaataaggttggagaaacagaatcatttccttggaacaat
actatgctgtcgtggcagagaacggcttttcattttcagccagagaagaattggatgaac
gatcctaacggtcctatgtactacaagggatggtaccactttttctaccaatataatcca
aacggtgccgtttggggagacatagtttggggacacgctgtgtcaagagacatgattcac
tggcttcaccttccactagcaatggttgctgatgaatggtatgacaagaacggtgtttgg
acagggtctgctaccatcttatctgacggtcaaatcgtcatgttatacaccggttccact
aacgaatccgttcaagttcaaaatcttgcataccctgctgatccctctgaccctctcctt
gtagattggatcaaatacccttccaatccggttctcttccctccaccaggtatcctttct
aaggattttcgcgatccaacaacggcttggcttactgctgaaggtaaatggcgcataacc
ataggatccaagattaacaaaactggtgttgctttggtttatgacacggtggacttcaag
acctatgagcgtaaacagggtttgcttaatgctgttcctggaacaggtatgtgggagtgt
gtggacttttttcctgtttctaagaaatctgaaaatgggttggatacttcttttaatggg
gatgaggttaaacatgtgatgaaagtgagcttggatgatgatagacatgattattatgca
ttggggatttatgatgagaagaaggttaagtttgtagcagatgatttgaaaaatgatgtt
ggtattggactaaggtatgattatggcatattttatgcttccaagacattttatgatgag
aaaaagcataggagagtcttgtggggttggattggagaatctgatagtgaatatgctgat
gtggccaaaggttgggcttctgttcagagcattccacgaattgtgaagcttgacaagaag
actggtagcaatttacttcaatggcctgttgctgaagtggaaagtttgagattaaaaagc
aatgaatttaaaaatttgaaggccaagccaggaacagtgatgtcactagatattgaaact
gccacacagttggacattctagctgaatttgagatagacaaagaagctttggagaaaacg
gctcataccaatttagagtatgagtgcagcatcagtggtggagcttcccaacgtggtgcc
ttaggaccttttggtcttttggttttggcagatgatggtctttctgagtatactcctgtg
tacttttatgttgttaaaggaagtaatggaaaccttaagacttctttctgctctgatcaa
tcaaggtcttctcaagcaaatgatgtccataagcaaatatttgggagtgtagttccagta
cttaaaggagaaaaattgtccctaagaatattggtggaccattcaattgttgaaagcttt
gctcaaggtggaaggacatgtgtgacatcaagagtttatccaacaagggcaatttatgga
gctgctcgattgttcttattcaacaatgctactgaggccactgttacagcctctcttaag
atttggcagatgaattccgcatttatacacccatttcgccctgatcagaagagctaa

DBGET integrated database retrieval system