KEGG   Cicer arietinum (chickpea): 101490583Help
Entry
101490583         CDS       T02819                                 

Definition
(RefSeq) probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00020  Citrate cycle (TCA cycle)
cam00640  Propanoate metabolism
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101490583
   00640 Propanoate metabolism
    101490583
Enzymes [BR:cam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101490583
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101490583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101490583
NCBI-ProteinID: XP_004515280
UniProt: A0A1S2Z578
Position
Un
AA seq 327 aa AA seqDB search
MGFQRVTKLVTSIASRHHHLRHQSSSSASSPAVFVDKSTRVICQGITGKNGTFHTEQAIE
YGTNMVGGVTPKKGGTEHLGLPVFNTVSEAKAETKANASVIYVPPPFAAAAIMESLEAEL
DLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIG
IVSRSGTLTYEAVYQTTAVGLGQSTCVGIGGDPFNGTNFVDCLTKFIADPQTEGIILIGE
IGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLRE
AGVTVVESPAKIGAAMFDIFKQKGLVQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccaacgcgttacgaaacttgtaacctcaatcgcctcccgccaccaccacctc
cgccaccaatcatcctcctccgcttcctctcctgctgtgttcgtcgacaagagcacgcgc
gtgatctgtcaaggaataacaggaaagaacggaacgtttcataccgaacaagcgatcgaa
tatggaacgaatatggttggtggtgttactcctaagaaaggtggaactgaacatttaggg
cttcctgttttcaacactgtttctgaagctaaagctgaaactaaagctaatgcttctgtt
atttatgttcctcctccttttgctgctgctgctatcatggaatctttggaggctgaattg
gatctcgttgtttgtatcactgaaggaattcctcaacatgatatggtgcgagttaaagca
gcacttaacagacagtccaaaactcgcttgataggaccaaactgccctggtatcatcaag
cctggggaatgtaaaattggaatcatgccgggttacattcacaaacctgggcgcatagga
attgtttctcgttctggcactttgacatatgaagcggtttaccaaacaaccgctgttggc
cttggacaatccacttgtgtgggtattggaggagatcccttcaatggaacaaactttgtt
gattgccttacaaagttcatagcagatcctcagacagaaggtatcattctcattggagag
ataggaggaactgcagaagaagatgctgctgcactaattaaggaaagcgggactgagaag
cccattgttgcatttattgctggattaactgctccccctggccgtcgtatgggtcatgca
ggagctatcgtgtcgggtggtaagggtactgctcaagacaaaatcagaaccctcagggaa
gctggagtcacagttgtggagtctcctgctaaaattggagctgccatgtttgatattttc
aagcagaagggtttggtgcaatag

DBGET integrated database retrieval system