KEGG   Cicer arietinum (chickpea): 101490711Help
Entry
101490711         CDS       T02819                                 

Definition
(RefSeq) probable methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00450  Selenocompound metabolism
cam00970  Aminoacyl-tRNA biosynthesis
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101490711
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101490711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cam01007]
    101490711
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cam03016]
    101490711
Enzymes [BR:cam01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101490711
Amino acid related enzymes [BR:cam01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101490711
Transfer RNA biogenesis [BR:cam03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101490711
 Prokaryotic type
   Other AARSs
    101490711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 101490711
NCBI-ProteinID: XP_004497294
UniProt: A0A1S2Y0B7
Position
Ca4
AA seq 606 aa AA seqDB search
MAVRVNCSLQNTLSLLNPSILSLRSTLSPPLKSKPHFNFFSNPNPSRRALFCNCATLTPS
NEEPYVITTPLYYVNAPPHMGSAYSTIAADAIARFQRLLGKKVIFITGTDEHGEKIATAA
MAQGSTPTDHCNLISQAYRTLWKDLDISYDKFIRTTDSKHEAIVKEFYSRVLASGDIYRA
DYEGLYCVSCEEYKDEKELLDNNCCPTHLKPCASRKEDNYFFALSKYQKSFEEILNKNPS
FVQPSFRLNEVQSWIKSGLRDFSISRASVDWGIPVPNDKSQTIYVWFDALLGYISALSDD
QEKPDLLNAVSSGWPATLHLIGKDILRFHAVYWPAMLMSAGLSLPKMVYGHGFLTKDGMK
MGKSLGNTLEPNDLVSKFGSDAVRYFFLREVEFGNDGDYSEERFINIVNAHLANTIGNLL
NRTLGLLKKNCQSTLVVDSVTAAEGNAFKDNVMRLVDKARSHYENLSLTSACEAVLEIGN
VGNSYMDERAPWSLFKQGGTASEAAAKDLVIILETVRIIAIALSPATPSLSWRIYEQLGY
SRDQFDETTWSDTKWGGLKGGQVMAQPKPVFARIENQTEVEDKGVAVGKTPKNKGKLKQA
QQVAGA
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgagagtgaactgttcgttacagaacacactctctctcctcaacccttccatt
ctctcactccgttccacactttcccctcccctcaaatccaagccccatttcaatttcttt
tcaaatccaaacccttctcgacgtgctttgttctgcaactgcgccaccctcactccctca
aatgaagaaccctatgtcatcaccacacctctctactacgtcaacgcccctccccatatg
ggtagtgcttactccaccatcgccgccgatgccattgctcgctttcagcggctattggga
aagaaagttatattcattactggcaccgatgaacatggtgagaaaattgcaactgctgcc
atggcccagggttccactcctactgaccattgcaatctcatttcacaagcttacaggact
ctttggaaagatctagatatttcgtatgacaagttcattagaacaactgatagcaaacat
gaagcaatcgtgaaggaattttattcgagagtgcttgccagcggcgatatttaccgagct
gattatgagggactttattgtgttagttgtgaggaatataaggatgagaaggaattgctt
gataataattgttgtccaacccacctaaagccttgtgcttcaaggaaagaggacaattac
ttttttgcactgtcaaaatatcagaagtcgttcgaagaaattttgaataaaaatccaagt
tttgtgcagccatctttccgtttaaatgaggttcaaagctggatcaaaagtggcttgagg
gacttttccatttcccgagcatcagttgattggggcatacctgttccgaatgacaagtct
cagacaatatatgtatggtttgatgctttactaggctatatatcagcactatctgatgac
caggaaaaacctgatttactaaatgctgtttcttcaggttggccagctacactgcacttg
attggtaaggatattctacgtttccatgccgtttattggccagctatgttaatgtctgct
ggattaagccttcccaaaatggtatacggccatggattcttgacaaaggatggcatgaag
atgggaaaatcactaggaaatacgcttgaaccaaacgatttggtgagtaaatttggatca
gatgcagttagatacttcttcctcagggaggtggaatttggcaatgatggggactattca
gaggaacgcttcatcaatatcgtaaatgcacatcttgccaatacaattggaaatcttctt
aatcgtacactaggacttctgaaaaagaactgccaatcaactctagtagtggattcagtt
acggctgcagaaggaaatgcgttcaaggataatgtaatgaggctggttgataaagctcgt
agtcactatgaaaatctctctctgacatcagcttgtgaggctgttctagagattggtaat
gtaggtaattcctatatggatgaacgtgccccttggtctctctttaagcaaggaggtact
gcttctgaagcagctgccaaggaccttgtaattatattagagacagtgagaattattgcc
attgcactatctcctgctaccccaagcttgagttggagaatatatgaacaacttggctat
tccagggaccaatttgatgaaacaacatggagtgacaccaagtggggtggacttaaaggt
ggccaggtcatggctcaacctaaaccagtttttgctaggattgaaaaccaaactgaagtg
gaagacaaaggggttgcagtcggtaagactccgaaaaataaagggaagttgaaacaagct
caacaagttgctggagcttag

DBGET integrated database retrieval system