KEGG   Cicer arietinum (chickpea): 101491000Help
Entry
101491000         CDS       T02819                                 

Definition
(RefSeq) isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00020  Citrate cycle (TCA cycle)
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
cam01210  2-Oxocarboxylic acid metabolism
cam01230  Biosynthesis of amino acids
Module
cam_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101491000
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     101491000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 101491000
NCBI-ProteinID: XP_004512246
UniProt: A0A1S2YZ72
Position
Ca8
AA seq 368 aa AA seqDB search
MATRRSAPHLLKQLFASRHHLNPTRHVTYMPRPGDGTPRSVTLIPGDGIGPLVTGAVEQV
MEAMHAPIYFEKYEVHGDMKAVPSEVLESIKKNKVCLKGGLATPMGGGVSSLNVQLRKEL
DLYASLVNCFNLPGLPTRHDNVDIVVIRENTEGEYSGLEHEVVPGVVESLKVITKFCSER
IAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVATKYPGIKYNEIIVDNCCMQ
LVSKPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGADYAVFEQGASAGNVGNDK
VVQQKKANPVALLLSSAMMLRHLQFPAFADRLETAVKRVILEGRYRTKDLGGTSTTQEVV
DAVIDALH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagacgatccgcaccacaccttctcaaacagctcttcgcctcacgccaccac
ctcaacccaacccgccacgtaacctacatgcctcgtcccggagacggaacaccacgaagc
gtaactctcatccccggcgacggaattggaccactagtaaccggcgcagtcgaacaagta
atggaagcgatgcacgctcctatttacttcgagaaatacgaagtccacggtgacatgaag
gcggtgccatcagaagtgctggaatcaataaagaagaataaggtttgtttgaagggagga
cttgctactcctatgggcggtggtgttagttcccttaacgtgcaattgaggaaggaactt
gatctctatgcttcacttgttaactgctttaacctccctggtttgcctacaaggcatgat
aatgttgatattgttgttattagggagaatactgagggagagtattctggccttgaacat
gaggttgttcccggcgttgttgaaagcctcaaggtaataacaaagttctgttcggagcgc
attgctaaatatgctttcgagtatgcttatctaaataacagaaagaaggtgactgctgtg
cacaaagcaaacatcatgaaacttgcagatggtttattcttggaatcttgtcgagaggtt
gctacaaagtatcctggaatcaagtataatgaaattattgtagataactgttgcatgcag
cttgtttcaaagcctgaacaatttgatgtcatggtaactcccaatctttatggaaatctt
gttgcaaatacagcggcaggcattgctggaggcactggtgtcatgccaggaggtaatgtt
ggggctgactacgctgtatttgaacaaggagcttcagccggaaatgttggtaacgacaaa
gtagtgcaacaaaagaaagccaaccccgtggcactcctcctttcatcggcaatgatgctt
agacatcttcagtttcctgcattcgctgaccgattggaaactgctgtcaaaagagtcatt
ttagagggaagataccggacaaaggaccttggaggtacaagcaccacccaagaggttgtt
gatgccgtgatagatgcattacattaa

DBGET integrated database retrieval system