KEGG   Cicer arietinum (chickpea): 101491085Help
Entry
101491085         CDS       T02819                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase Pin1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cam03021]
    101491085
   03110 Chaperones and folding catalysts [BR:cam03110]
    101491085
Enzymes [BR:cam01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101491085
Transcription machinery [BR:cam03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     101491085
Chaperones and folding catalysts [BR:cam03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    101491085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase Rotamase_3 Rotamase_2 X8
Motif
Other DBs
NCBI-GeneID: 101491085
NCBI-ProteinID: XP_004509352
UniProt: A0A1S2YSU2
Position
Ca7
AA seq 124 aa AA seqDB search
MSSSNRQGGGEVRASHILIKHEGSRRKASWKDPEGYVIKNTSRDSAVAILKAMQNDIVSG
KATFEDIASRYSDCSSAKRGGDLGAFGRGQMQKPFEDATFALKVGELSDIVDTDSGVHII
KRTN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatcaaacagacaaggcggtggtgaagttagggcatcgcacatattgataaaa
cacgaaggttctagaaggaaagcttcgtggaaagatccagaaggttacgtcatcaagaac
actagtagagatagtgccgttgctatccttaaggcaatgcaaaacgacatcgtttctggt
aaggcaactttcgaagacattgcttctcgttactcagattgtagctctgctaaacgcggc
ggcgatctcggtgcttttggtcgtggccagatgcagaagccatttgaagatgcaactttt
gctcttaaagttggtgagcttagtgacattgtggatactgacagtggagtccacataatc
aagagaacaaattga

DBGET integrated database retrieval system