KEGG   Cicer arietinum (chickpea): 101492033Help
Entry
101492033         CDS       T02819                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00906  Carotenoid biosynthesis
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Module
cam_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    101492033
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     101492033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 101492033
NCBI-ProteinID: XP_004488719
UniProt: A0A1S2XFU6
Position
Ca1
AA seq 620 aa AA seqDB search
MATSATTASNTWINTKLASSSYSSPFKDLSLNSNSNSITLNKKNSTSKNRISCSLQTTLP
FPKQYQPKPKPKPTTTTTTIIPTKETKPNPPPSETKPKQQQKNQKWNLFQKAAATALDFV
ETTLITQERKHPLPKTADPRVQISGNFAPVPEHPVTHSLPVTGKIPKCIDGVYLRNGANP
HYEPVAGHHFFDGDGMVHAVKFTNGSVSYSCRFTETHRLAQEKALGRPVFPKAIGELHGH
SGIARLMLYYARSLFNLVDGSHGMGVANAGLVYFNNRLLAMSEDDIPYQIRVTPNGDLTT
VCRYDFNNQLKSTMIAHPKVDPIDNNLYALSYDVIQKPYLKYFRFDSNGVKSPDVEIPLA
EPTMMHDFAITENFVVVPDQQVVFKLGEMIRGGSPVVYNKEKVSRFGVLPKNAKDSSDMK
WIDAPDCFCFHLWNAWEEKENDEVVVIGSCMTPADSIFNECEESLKSVLSEIRLNLKTGK
STRRAIIDESQHVNLEAGMVNKNKLGRKTQFAYLALAETWPKVSGFAKVDLFSGQVNKYL
YGDQRFGGEPLFLPTLDSNSGREDDGYILTFVHDEKEWKSELQIVNAITLKLEASIKLPS
RVPYGFHGTFIHSNDLKKQA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatcagccacaacagcatcaaacacatggattaacaccaaacttgcatcatca
tcatactcatctcctttcaaagatttgagcttaaattcaaattccaattcaatcacctta
aataagaaaaattccacctccaaaaacagaatctcatgctcactccaaacaacactccct
ttcccaaaacaataccaaccaaaaccaaaacccaaacccacaacaacaacaacaaccata
atccccacaaaggaaacaaaaccaaatccaccaccttccgaaacaaaacccaaacaacaa
caaaaaaaccaaaaatggaaccttttccaaaaagccgcagccaccgccctagacttcgtg
gaaacaaccttaataacacaagaacgcaaacacccacttcccaaaaccgccgacccacgt
gtccaaatctccggaaatttcgcaccagtaccggaacacccggtaacccactccctccca
gtaaccggcaaaatcccaaaatgcattgacggcgtctacctccgtaacggcgcaaaccca
cattacgaaccggtagccggtcaccactttttcgacggagacggtatggtccacgctgtg
aaattcactaacggctccgttagttactcttgccgcttcaccgaaacccaccgtttggcc
caagaaaaagccttgggccgtcccgttttccccaaagccataggcgaacttcacggtcat
tcaggcatagcccgtcttatgttatactacgcccgttccctcttcaatctcgtagatggg
tcccacggaatgggcgttgctaacgccggtttagtttatttcaataaccgtctgttagct
atgtctgaagacgatatcccttatcaaattcgcgtaactcctaacggcgatttaaccacc
gtttgccgttacgatttcaataaccaacttaaatcaacaatgatcgcacacccaaaagtt
gatccaattgataacaatttatacgcattaagctacgacgtgattcagaagccttatctg
aaatacttccgtttcgattctaacggcgttaaatcccctgacgttgaaattcccttagca
gagccaactatgatgcatgatttcgctatcaccgagaatttcgtggttgttcctgatcaa
caagttgtcttcaaattaggcgaaatgatccgcggtggctcccccgttgtttataacaaa
gagaaagtttctcgtttcggtgttttaccaaagaatgctaaagattcttctgatatgaag
tggattgatgcacctgattgtttctgttttcatctatggaatgcttgggaggaaaaggag
aatgatgaagttgttgtcattggttcttgtatgacacctgcagattccattttcaatgaa
tgtgaggagagtttgaagagtgttttatctgaaatcaggttgaatttgaagacagggaaa
tccacacgaagagctattattgatgaatctcaacatgttaatttggaagctgggatggta
aacaagaacaaactggggagaaaaactcagtttgcttatcttgctcttgctgaaacgtgg
cctaaagtttctgggtttgccaaagttgatctttttagtggtcaagtcaacaaatatctt
tatggggatcaaagatttggtggtgagcctctgtttttacctactttggattccaattct
ggaagggaagatgatggttatattttgacatttgttcatgatgagaaagaatggaaatct
gagcttcaaatcgtcaatgctatcactttgaaacttgaagcttctattaagcttccttct
cgtgttccttatggctttcatggaactttcatacattcaaatgatttgaagaaacaagca
taa

DBGET integrated database retrieval system