KEGG   Cicer arietinum (chickpea): 101495183Help
Entry
101495183         CDS       T02819                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cam04131]
    101495183
Membrane trafficking [BR:cam04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101495183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 101495183
NCBI-ProteinID: XP_004511179
UniProt: A0A1S2YWT0
Position
Ca7
AA seq 1836 aa AA seqDB search
MLQLRHRRDSTPATTRWRNKFDENLEQWPHLNELVHCYTTDWVKDENKYGHYESIGTPSF
HNQIYEGPDTDIETEMRLAGARRTKGEDISEDDIPSTSGRQFMEAADGEHSDVPKHFGHS
PLPAYEPAFDWENERSLIFGQRIPETPISHGMKISVKVQSLQFQAGLAEPFYGTICLYNR
ERREKLSEDFYFHVLPTEMQGAKITCEPRAIFYLDVPSASVCLLIQLEKHATEEGGVTPS
VYSRKDPVHLTEREKQKLQVWSQIMPYKESFSWAIVSLFDGSIGAASAGPASPSSPLAPS
VSGSSTHEGVFETSTKVSLDGKMSYSNGNSVVVEVSNLNKVKESYTEESLQDPKRKVHKP
VKGVLRLEIEKHQISQADLETMSECGSATNDSVDPGDRIADSMSGKYPSNGCDDPQGSIS
KWNFSDAKEILGNGTNQHGNSDFNADDFHAFDFRTTTRNEPFLQLFHCLYVYPLTVSLGR
KRNLFIRVELREDDGDIRRQPLEAIYPRDPGLETSYQKWGHTQVAVGARVASYHDEIKLS
LPAMWTPMHHLLFTLFHVDLQTKLEAPKPVVIGYAALPLSSHAQLRSEINLPILRELVPH
YLQDAGRERLDYLEDGKNVFRLRLRLCSSLYPINERIRDFFLEYDRHTLRTSPPWGSELL
EAINSLKNVDSTALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNIVTRVQQESVDDAE
RNHFLVNYVDCAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLE
LIVKSMALEKTRLFYHSLPIGEDIPPMQLKDGVFRCIMQLYDCLLTEVHERCKKGLSLAK
RLNSSLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQSVLHECKLTFLQIICDHDLFVE
MPGRDPSDRNYLSSVLIQELFVTWDHEDLSLRAKAARILVVLLCKHEFDVRYQKPEDKLY
IAQLYLPVIGQILDEMPVFYNLNSVEKREVSIVILEIVRNLDDASLVKACQQSIARTRLF
FKLMEECLLLFEHKKPADGMLLGSSSRNPIGEAPASPKYSERLSPAINNYLSEASRQEVR
PQGTPDNGYLWQRVNSQLSSPSQPYSLREALAQAQSSRIGASAQALRESLHPLLRQKLEL
WEENLSASVSLQVLEVTEKFSTMAAKHSIATDYGKLDCITAVFMSFLSRNQPLSFWKAFF
PVFNSVFDLHGATLMARENDRFLKQVTFQLLRLAVFRNENIRKRAVVGLQILVRCSFHYF
TQTARLRVMLIITLSELMSDVQVTQMRSDGSLEESGEARRLRKSLEEMKDETKSSFLLEE
CGLLESALVAIPEKKAEHKWSWSEVKYLSDSLLLALDGSLEHALLSPVMTMDRYAAAESF
YKLAMAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVVMQALVARKDGVWNKD
HVASLRKICPMVSNEITSEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELFHFCAS
ILELVIPVYKSRRAYGQLAKCHTLLTNIYESILEQESSPIPFTDATYYRVGFYGDRFGKL
DKKEYIYREPRDVRLGDIMEKLSHIYESRMDGNHTLHIIPDSRQVKAEELQPGVCYLQIT
AVDAVMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVL
QTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQS
LQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHF
RLIGEEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagcttcgccaccgtcgagattctactccggccaccactaggtggcgtaacaag
tttgatgagaatctggagcagtggccgcatctcaatgagcttgttcattgctacactacg
gattgggttaaggatgagaacaaatacggtcactatgaaagtattggaacgccgtcgttt
cataaccagatatatgaaggccccgacactgacattgaaaccgaaatgcggcttgctggt
gcaagacgaacgaagggtgaagacattagtgaagatgacatccctagtacttcaggaagg
cagtttatggaagctgcagatggtgaacattcggatgttccaaagcattttggtcactct
cctcttcctgcttatgagccagcgtttgattgggaaaatgagaggtcattgatatttgga
caaaggataccggaaactcctatatcacatggaatgaagatatctgtgaaggttcagtct
ttacaatttcaagcaggattggctgagcccttttatggtacaatttgcttatacaatagg
gagagaagagagaaattatcggaagacttttactttcatgtcttaccgactgaaatgcag
ggtgccaaaattacctgtgaacctcgtgcaattttttacttagacgtgccttctgcttca
gtttgtttgttaatccagttggagaagcatgctaccgaagaaggcggagttactccttct
gtttattcacgtaaagatccagtgcatttgactgagagagagaagcaaaaattgcaggtg
tggtctcaaatcatgccttacaaagaatccttctcatgggccattgtgtcattatttgat
ggcagtattggtgcagcttcggcagggcctgcttccccaagcagccctcttgctccaagt
gtatctggttcaagtacacatgaaggtgtttttgagactagtacaaaagtctctttagat
ggaaagatgagttactcaaatggaaattctgttgtggttgaggtttcaaacctaaataaa
gtcaaagaaagttatactgaggaatcacttcaggatcccaaacgtaaagtgcataaacct
gtcaaaggagttttgagactggaaattgaaaagcaccagatttctcaagctgatttggaa
actatgtcagaatgcggcagtgcaaccaatgattctgttgatcccggggatcgcattgca
gattccatgtctggaaagtatcctagtaatggttgtgatgatcctcagggtagtatctcc
aagtggaatttcagtgatgcgaaagaaattttgggcaatggaacaaatcaacatggaaac
tcggattttaatgctgatgatttccatgcttttgacttccgcactacaacgagaaacgag
ccgtttttgcaactttttcactgcctgtatgtgtatccattgaccgtaagtttgggtagg
aaaaggaatttgtttatacgggttgaactcagagaggatgatggtgatattcgcagacag
ccattggaggcaatttatcctagagatccaggtctagagacatcatatcagaagtggggt
cacactcaagttgcagttggggctagggttgctagctaccatgatgaaattaaactttcc
cttcctgccatgtggacaccaatgcaccaccttctatttactttatttcatgttgatctg
caaacaaaattggaagctccaaagccagtggtcattggatatgcagctcttcctttatcg
tcacatgctcagctgcggtcggaaataaatcttccgattttgagagagttggtcccacat
tatctccaggatgcaggacgggagagattggattatttggaagatggaaaaaatgtcttc
agattgcgtttacggttatgttcttctttataccctatcaatgaacgtattagagatttt
tttcttgaatatgatcgacacacgcttcgaacaagtccaccttggggttctgaattgctg
gaggctattaatagtttgaagaatgttgactctactgccttacttcagtttcttcatcca
attcttaacatgttgcttcatcttattggcaatggtggagaaacactccaggttgcggct
ttccgggctatggttaatattgtaactagggtgcagcaggagtcagttgatgatgctgaa
agaaatcattttcttgtcaactatgtcgattgtgcttttgatgattttgggggtcgtcaa
ccaccagtatatcctggattatccactgtatggggaagtttggcacgaagtaaggctaaa
gggtatcgggttggacctgtgtatgatgatgttttggcaatggcatggttttttctggag
ttaattgttaaatcaatggcattggagaagactcgcctcttctatcatagccttcccata
ggtgaagatatcccaccaatgcagttgaaggatggggtgttcagatgcataatgcagttg
tatgattgccttctcaccgaggtgcatgagcgctgcaagaagggtttaagcttggcaaag
cgcttgaacagtagtttggccttcttttgttatgatcttctatcaattattgagccacga
caagtttttgagttggtatcattatatctcgataagttctctggtgtatgtcaatcagtt
cttcatgagtgcaaacttacctttctacaaataatctgtgaccatgatctttttgttgaa
atgcctgggagagatccttcagataggaactacctttcgtctgtattgatacaagaactc
tttgttacttgggatcatgaagatttatctctacgggcaaaggcagcaagaatcttggta
gtgctcttgtgcaagcacgagtttgatgtgagataccaaaagcctgaagataagttgtat
attgctcagctatatttgccagttattggacagatattagatgagatgcctgttttttac
aacctgaattctgttgagaagcgtgaagtttccattgtaattctggaaatagttcgaaac
cttgatgatgcatcactggtcaaggcatgccagcaaagcattgcccggactagattgttt
ttcaagctcatggaggagtgcttacttctatttgagcacaaaaaacccgctgatggcatg
ttacttggctctagttctcgcaaccccataggggaggcacctgcttcccccaaatactct
gagagactttctcctgcaatcaacaactatctatctgaggcctcaaggcaggaagtcagg
cctcagggaacacctgataatggatatttatggcagagagtaaattcccagttaagctct
cctagccagccatattccttgagagaagctcttgcccaagcacagtcttctagaattgga
gcttctgctcaagcacttcgtgaatctttgcatccacttttgaggcaaaaattggaactt
tgggaagaaaatttgagcgcttctgtcagtcttcaggtcttggaagtgactgaaaaattt
tccaccatggcagcaaagcatagcattgctactgattatggaaaacttgattgcatcaca
gctgtattcatgagctttctgtctagaaatcaaccgttgtcgttttggaaagcatttttt
ccggtatttaacagtgtgtttgatttacatggggcaactctgatggcaagagaaaatgat
cgttttctaaagcaagtcactttccagcttctacggcttgcagttttcagaaatgaaaac
attaggaaaagggcagttgttgggcttcaaatacttgtgaggtgttcatttcattacttt
acgcagacagcaaggttaagagtcatgttgatcatcactttatcagagctaatgtctgat
gttcaagtgactcaaatgagatctgatggaagcctagaagagagtggtgaagcacggaga
cttagaaaatctttagaggaaatgaaggatgaaactaaaagttctttcctgttggaggag
tgtggactacttgagagtgctcttgtagctataccagaaaaaaaggcagagcataagtgg
tcctggtcagaggtgaaatatctctctgacagtcttcttttggcccttgatggtagtttg
gaacacgcactattgtcgcctgtgatgactatggatagatatgctgctgctgaaagcttc
tataaactggcaatggcatttgccccagtccctgatcttcacataatgtggttacttcat
ctatgtgatgcacatcaggaaatgcagtcatgggctgaagctgctcaatgtgctgtcgct
gttgctggtgttgtaatgcaggcccttgttgctaggaaagatggtgtttggaacaaagac
catgttgcttctttacgtaagatttgtcctatggttagcaatgagataacttctgaagca
tccgctgcagaggtagagggatatggtgcttcaaaattaacagttgactctgctgtgaaa
tacctgcagctagctaataagcttttttcacaagctgagctttttcatttctgtgcaagc
attctggaacttgtaatcccagtttacaagagcagaagggcttatggacagcttgctaaa
tgtcacactctacttaccaatatctatgaatcaatacttgaacaggaatctagtccgatt
ccttttactgatgcaacatactacagggttggattttatggtgatagatttggaaaactt
gacaaaaaggagtatatatatcgtgaacctcgtgatgtacgtctaggggacatcatggaa
aaacttagtcacatatatgagtccagaatggatggtaatcacactttgcatattattcca
gattctcgacaagtgaaggctgaagagttacagcctggtgtctgctaccttcagatcacc
gctgttgatgcagtcatggaagatgaggatttaggaagtagaagggagagaattttctcc
ctttcgactggaagtgttcgtgctcgtgtgtttgacagatttttgtttgataccccattt
acaaaaaatggcaagactcaaggtgggttggaagatcaatggaagagacgcactgttctt
cagactgagggttcatttccagctttagtaaataggctactggtaatcaaatctgagtcc
cttgaattttcacctgtggaaaatgccattggaatgattgaaacacgaacagctgcatta
agaaatgagcttgaagagcctcgaagttctgaaggggatcaacttccacggctccagagt
ctgcaaagaatcctccaaggcagtgttgcagtacaagtaaacagtggagttttgagtgtt
tgcacagccttcttgtctggcgagcctgctacaagattgcggtcacaggaactacaacaa
cttatagctgcccttcttgagttcatggctgtttgcaaacgagccatccgggtacatttc
agattgattggtgaggaagatcaggatttccatacacaacttgtaaatggatttcagtct
ctaactgcagagttatcgcattatattcccgccatcctctccgagctatga

DBGET integrated database retrieval system