KEGG   Cicer arietinum (chickpea): 101495616Help
Entry
101495616         CDS       T02819                                 

Definition
(RefSeq) vacuolar-sorting receptor 1
Organism
cam  Cicer arietinum (chickpea)
SSDB OrthologParalogGFIT
Motif
Pfam: PA cEGF EGF_CA FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 101495616
NCBI-ProteinID: XP_004511312
UniProt: A0A1S2YX15
Position
Ca8
AA seq 623 aa AA seqDB search
MKVWRFSVFFFVAFLLLTLSMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMA
GTVVYPKDNNKGCKDFDQSFKSRPGALPTILLLDRGNCFFALKVWNAQKAGASAVLVADD
IEEPLITMDTPEEDGSSAKYIENITIPSALIEKSFGEKLKDAISGGDMVNVNLDWREAVP
HPDDRVEYELWTNSNDECGVKCDMLIEFLKDFKGAAQILEKGGYTQFTPHYITWYCPHAF
TLSKQCKSQCINHGRYCAPDPEQDFSTGYDGKDVVVENLRQLCVFKVAKETEKSWVWWDY
VTDFQIRCPMKEKKYNKECANTVIKSLGLDIEKIDKCMGDPEADTENSILKEEQDAQIGK
GSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSNDVETNECLANNG
GCWQDKAANITACKDTFRGRVCECPLVGGVQFKGDGYTTCEAGGPGRCKINNGGCWHDAR
NGHAYSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCSC
RGDLLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIRA
IMAQYMPLDSQAEVPNHVNHQRA
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttggaggttttccgtgtttttctttgtagcttttctgttgcttactctttca
atggcgagattcgttgtggagaagaacagcttgtcggttacttcgcctgataaaattaaa
ggcagacacgacagtgccatcggtaacttcggtatacctcaatacggaggtagcatggcc
ggtaccgtcgtttatccaaaagataacaataagggttgtaaagacttcgatcaatctttc
aaatctcgccccggtgctcttcccaccatccttttgctcgatcgtggaaattgcttcttt
gctttgaaggtatggaatgcccaaaaggctggagcttctgcagttcttgttgcagatgat
atagaggaacccttaataactatggacacacccgaagaggatggttcgtctgcaaaatac
attgagaacataacaataccatctgctctcattgaaaagagttttggtgagaagttaaag
gatgccataagtggtggggatatggtcaatgtaaatcttgactggagagaggctgttccg
caccctgacgatcgtgtcgagtatgagttgtggaccaatagcaatgatgagtgtggagtt
aaatgtgatatgttaattgaatttttgaaggatttcaagggtgctgcacagatcttagag
aaaggaggttacactcagtttacacctcattatataacttggtactgtcctcacgcgttc
acattgagtaaacagtgtaagtctcaatgtataaaccatggaagatattgcgctccggat
cctgagcaggacttcagcacaggttatgatgggaaagatgtggttgttgaaaacttaagg
cagctatgtgttttcaaggtggcaaaggaaacagagaagtcttgggtgtggtgggactat
gtcactgattttcaaattagatgcccgatgaaggagaaaaagtacaataaggaatgtgcg
aacaccgtcattaaatctctgggtcttgacatcgaaaagattgataagtgcatgggagat
cctgaagccgatactgaaaattccattttgaaagaagagcaagatgcccaaattgggaag
ggatcacgtggtgatgttaccatattgcctactcttgttgtcaataacagacaatatcga
ggtaaactggagaaaggtgccgttctaaaggctatttgttctgggtttgaggaaactacc
gaaccagctgtttgtttgagcaatgatgtggagacaaatgagtgcctggcaaacaacggt
ggttgttggcaggataaagcggctaatatcactgcatgcaaggatacattccgtgggcga
gtatgcgaatgccccctggttggtggtgttcaatttaaaggagacggttatacgacttgt
gaagctggtggacctgggcgttgcaagattaacaatggaggctgttggcatgatgctcgg
aatggacatgcatattctgcttgtttggatgatggaggagttaaatgccagtgtcctaca
gggtttaaaggtgatggtgtaaaaaactgtgaagacattgatgaatgcaaagacaagaaa
gcttgtcagtgccctgaatgtagctgcaagaatacttggggcagctataactgcagttgt
aggggagatctgctgtatatcaaggaccaagatacctgcatcagtaaaactgccagtcag
ggaagatccacttgggctgctttttgggtcattctgattggcttggttatgatttctgga
ggggcattccttgtgtacaaatatagaattaggcaatacatggattctgaaatcagagca
atcatggcacaatatatgcccttggacagccaagcagaagttccaaatcatgtcaatcat
caaagagcttga

DBGET integrated database retrieval system