KEGG   Cicer arietinum (chickpea): 101496054Help
Entry
101496054         CDS       T02819                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cam01001]
    101496054
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101496054
Protein kinases [BR:cam01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101496054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Mid2 TMEM154 EphA2_TM Adeno_E3_CR2 APH Herpes_gE ABC1
Motif
Other DBs
NCBI-GeneID: 101496054
NCBI-ProteinID: XP_004512025
UniProt: A0A1S2YYQ3
Position
Ca8
AA seq 662 aa AA seqDB search
MSSPTDSSPDNSTPDNSTPDNSTPDDADNSSSPPSPPSQSPPSQSPPSQSPPSQSPPVEP
PPQSPPPSPPSQPPPSPSPSPPSPSQSPPTPSQSPPPSPPSQSPPSPSQSTQPSPPPHTP
NNPSPPSPNGGSQPPPPVAGRSPSTGSGSTPHKSLPNTPSSGNSNDNYNNDNNSNDDTKA
IIGAVIGVGGVLLIFIIVCVICTRKKKRKQMYYYGDHPSHGKGNNNNYYNSGPPPNYYGG
PHGEHVVRVQNGMGPNGGGGWGAPPPLNLMSSADMSSNYSTGPPPLPPPSPNLALGLKGG
TFTYEELAAATDGFIDANLIGQGGFGYVHKGVLPSGKEIAVKSLKSGSGQGEREFQAEID
IISRVHHRHLVSLVGYCISGGQRMLVYEFIPNNTLEFHLHGKGRPTMDWPTRMRIAIGSA
KGLAYLHEDCHPRIIHRDIKAANVLIDDSFEAKVADFGLAKLTSDNNTHVSTRVMGTFGY
LAPEYASSGKLTEKSDVFSFGVMLLELVTGKRPVDVTITMDDSLVDWARPLLTRGLEEDG
NFSELVDPFLEGNYNPQELTRMAACAAASIRHSAKKRPKMSQIVRTLEGDVSLDDLKDTI
RPGHSTVNTSSSGSSEYDTMQYNADLQKFRKAVFSSQEEFGNSSCSSGDMSQTSKQKPQQ
FL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccctactgactcttctccagataactccacacctgataactccacaccagac
aatagtacccctgatgatgctgataactcttcttcgccaccatcaccaccatcacaatca
ccgccatcacaatcaccgccatcacaatcaccaccatcacaatcaccaccagtagaacca
ccaccacagtcaccgccaccatcaccgccttcacagcccccgccctccccttcaccatcc
ccaccatctccttcacaatcaccgccaactccttcacagtcaccaccaccttcaccgcct
tcacaatcaccaccatcaccttcacaatcaacacaaccttctcctcccccacatacacca
aacaacccatcccctccatcacccaatggaggctcacagccaccacctccggtagcgggc
cgttcaccctcgaccggatccggatcaaccccacacaaatcattacctaatacaccatct
tcaggaaattcaaatgataattacaataatgacaacaacagtaatgatgataccaaggca
ataattggagcagtgattggagtgggaggtgttcttctcatttttatcattgtttgtgtt
atttgcaccaggaagaagaaaagaaagcaaatgtactattatggagatcacccatctcat
ggaaaagggaataataataactattacaacagtgggccgcccccaaattactacggaggt
ccacatggggaacatgttgttagggtacaaaatggaatgggtcctaatggtggtggtggg
tggggtgcaccacctcctctgaacctaatgagcagtgcagacatgagctcaaattactcg
accggaccacctcctttgcctcctccctcaccaaaccttgctttagggcttaaaggaggc
accttcacttatgaggaattggccgcggcaaccgacggattcatagatgccaatttgata
ggacaaggtggtttcggttatgtccataagggtgtgttgcccagtggaaaggaaatagct
gtcaagagtttaaaatcgggtagcggccaaggagagcgggagtttcaagctgagattgac
ataatcagccgtgttcatcatcgtcatcttgtctcacttgttggatactgtatttctggt
ggtcaaagaatgttggtctatgaatttattccgaataacacgttggagtttcaccttcat
ggaaagggtcgacctaccatggattggccaactagaatgaggattgcaataggttctgct
aaagggcttgcttatcttcacgaggattgtcatcctcgcatcattcatcgtgacatcaaa
gctgcaaatgtccttatcgatgatagctttgaagcaaaggttgctgattttgggttggct
aagttaaccagtgacaataatactcatgtatcaactcgtgtcatgggaactttcgggtac
ctagcccctgaatatgcatcaagtggaaaattgacagagaagtctgatgttttctcattt
ggggttatgctattggaactggtaactggaaagcgacctgtggacgtcacaattaccatg
gatgacagcttagtggattgggctagaccactactaactcgtggactggaggaggatgga
aactttagtgagttggtggatccatttttggaaggaaactacaatcctcaagaactcaca
agaatggcagcttgtgctgctgctagcattcgtcattctgccaagaagcgtcctaaaatg
agtcagattgtaagaacattggaaggagatgtttcactggatgatttgaaggatacaatt
aggccagggcatagcactgttaatacctcttcatctggtagttcagagtatgacacaatg
caatataatgctgatttgcagaagttcagaaaggcagtgttttccagccaggaggaattt
ggcaacagcagttgctccagtggtgatatgagccaaacttcaaagcagaagccacaacaa
tttctttaa

DBGET integrated database retrieval system