KEGG   Cicer arietinum (chickpea): 101496061Help
Entry
101496061         CDS       T02819                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03040  Spliceosome
cam04141  Protein processing in endoplasmic reticulum
cam04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101496061
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101496061
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101496061
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cam01009]
    101496061
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cam03041]
    101496061
   03009 Ribosome biogenesis [BR:cam03009]
    101496061
   03110 Chaperones and folding catalysts [BR:cam03110]
    101496061
   04131 Membrane trafficking [BR:cam04131]
    101496061
   03051 Proteasome [BR:cam03051]
    101496061
   03029 Mitochondrial biogenesis [BR:cam03029]
    101496061
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cam04147]
    101496061
Protein phosphatases and associated proteins [BR:cam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101496061
Spliceosome [BR:cam03041]
 Complex B
  Other components
   Prp19 complex
    101496061
 Complex C
   Prp19-CDC5 complex
    101496061
Ribosome biogenesis [BR:cam03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101496061
Chaperones and folding catalysts [BR:cam03110]
 Heat shock proteins
  HSP70 / DNAK
   101496061
Membrane trafficking [BR:cam04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101496061
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101496061
Proteasome [BR:cam03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101496061
Mitochondrial biogenesis [BR:cam03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101496061
Exosome [BR:cam04147]
 Exosomal proteins
  Proteins found in most exosomes
   101496061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 101496061
NCBI-ProteinID: XP_004492118
UniProt: A0A1S2XNN9
Position
Ca3
AA seq 649 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA
EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKK
KVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQLAEADEFED
KMKELEGLCNPIIAKMYQGGGAPDMAGGMNDDVPPSGSSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggagaaggtcctgcaatcggtatcgatctcggaacaacgtactcttgc
gtcggagtatggcagcatgatcgtgtcgaaatcatcgccaacgatcaaggaaaccgtacg
acgccgtcttatgtagggtttacggatactgagaggttgatcggtgatgctgctaagaat
caagtcgccatgaatcctgttaataccgtctttgatgcgaagcgtttgattggaaggaga
atttctgatgcttctgttcagagtgacatgaaactatggccattcaaggttattcccggt
cctgctgacaagccaatgattgtagttaactacaaaggtgaggacaagcaatttgctgcg
gaagagatttcctctatggttctcacaaagatgcgggagatcgccgaggcttatcttggt
tccaccgtgaagaatgctgttgttacagttcctgcttatttcaatgattctcagcgtcaa
gccacaaaggatgctggtgttattgctggtcttaatgtcatgcgtattatcaatgaaccc
actgctgctgctattgcttatggacttgataagaaggctacaagtgttggtgaaaagaat
gtgttgatttttgatcttggtggtggtacttttgatgtttctcttcttactattgaagag
ggtatctttgaagttaaagccactgctggtgatactcatcttggtggtgaagattttgat
aacagaatggttaaccattttgttcaagagtttaagaggaagaataagaaggatattagt
gggaaccctagggcacttaggagattgagaactgcttgtgagagagcaaagaggactctt
tcatctactgcacagaccaccattgaaattgattctctttatgaaggtgttgatttttac
actacaatcactcgtgcaaggtttgaggaactcaacatggatctcttcaggaagtgtatg
gagcctgtagagaagtgtttgagagatgcaaagatggataagagcacagttcatgatgtt
gttcttgttggtggttctactaggattccaaaagttcagcaattgttgcaggatttcttc
aatggaaaggaactttgcaagagcatcaaccctgatgaagctgttgcttatggagctgct
gttcaagcagctatattgagcggtgaaggcaatgaaaaggttcaagatttgttgcttttg
gatgttactccattgtctcaaggtttggaaactgctggtggtgtcatgactgtattgatt
ccaagaaacactacaattccaaccaagaaggaacaagttttctctacttactccgacaat
caacctggtgtcttgatccaagtctacgagggtgaaagagcaagaacaagagacaataac
ttgttgggaaaattcgagctttcgggcattcctccggctcctcgtggcgttcctcaaatc
actgtctgctttgacattgatgctaatggtatcttgaatgtctctgctgaggacaagaca
accggacagaagaacaagatcacaattactaatgataaaggtagactctcaaaagacgag
attgagaagatggtgcaagaagcagagaaatacaaggctgaagacgaggaacacaagaag
aaggtggatgcaaagaatgctttggaaaactatgcttacaacatgaggaacacaattaaa
gatgagaaaattggttcaaagctttcacctgaagacaagaagaagattgatgatgcaatt
gaagcttctattcagtggttggatagtaaccaattggcagaggctgatgagtttgaagat
aagatgaaggaacttgagggtctttgtaatccaatcattgcaaagatgtaccaaggtggt
ggtgctcctgatatggctggtggtatgaatgatgatgttcctccatctgggtctagtggt
gctggccccaaaattgaagaagtcgattaa

DBGET integrated database retrieval system