KEGG   Cicer arietinum (chickpea): 101496144Help
Entry
101496144         CDS       T02819                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 1
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00562  Inositol phosphate metabolism
cam01100  Metabolic pathways
cam04070  Phosphatidylinositol signaling system
Module
cam_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101496144
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101496144
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     101496144
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     101496144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 101496144
NCBI-ProteinID: XP_004508870
UniProt: A0A1S2YRQ9
Position
Ca7
AA seq 314 aa AA seqDB search
MCEVEVSARVGFALEPKKLESFLQPSLLHYAKQHGINLVQIDLNTPLSQQGPFHCIIHKL
HTQNWKQQLHEFSSKHPNTIIIDPPELVDCLHNRVTMLESVTHLKLSIENITVEIPNQIV
VKEPKSFDFDTIEELDSTWKFPSIAKPLEANGTVDSHKLFLVFDRDGVNSLNNPMVLQEF
MNHGGVVFKIYVAGQHCNCVKRKSLGDLSKEKLKKVKGSLPFSQVSNLSVQEDDEGGVDK
AEMPPQSLIIELARALREGLGLNLFNVDVIRDGKNPRRYLVIDINYFPGYAKLPSYESFF
TNFLLDIVQQRNIV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagttgaggtctcagctcgagtaggctttgcactcgaacccaagaaactcgaa
agctttcttcaaccatcactcctccattatgccaaacaacacggcatcaacctcgtacaa
atcgacctcaacacacccttgtctcaacagggtcctttccactgcatcatccacaaactc
cacacccaaaactggaaacaacaattgcatgaattctcatctaaacacccaaacacaatc
atcatcgatccccctgagctggtagattgtcttcacaatcgcgttaccatgctcgaatca
gtgacccacttaaaactttcaattgaaaacatcactgtcgaaattcccaaccaaattgtc
gtgaaagaacctaaatccttcgatttcgacacaatcgaagaactggattcgacttggaag
ttcccttccatagcaaaaccgttggaagctaacggcaccgtcgattctcacaaactgttt
ttagtttttgaccgtgacggcgtcaactcgttgaataatccaatggttctgcaagagttt
atgaaccatggtggggtcgttttcaagatttacgttgctgggcagcactgtaattgcgta
aagcgtaagtctttgggggatttatcaaaggagaagctcaaaaaggttaaagggtcattg
ccgttttctcaagtttccaacttgagtgttcaagaagatgatgaaggtggtgttgataaa
gctgaaatgccacctcagagtttgattattgagttggcaagagctttgagggaaggattg
ggacttaaccttttcaatgttgatgtgattagagatggtaaaaatccgagaaggtacctt
gtgattgatattaattactttcctgggtatgcaaaattgccatcttatgagtcatttttc
accaattttttgttggatattgtgcaacaaagaaatattgtttag

DBGET integrated database retrieval system