KEGG   Cicer arietinum (chickpea): 101496797Help
Entry
101496797         CDS       T02819                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101496797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 101496797
NCBI-ProteinID: XP_004507858
UniProt: A0A1S2YPF2
Position
Ca7
AA seq 705 aa AA seqDB search
MQDSSSMKFSPLDLMSAIIKGKLDPSNVSSQVSASLMLENREFVMLLTTSVAVLIGCVVV
LIWRRSNAQKSKPIEVPKRIIDKLPELDVDDGTKKVTVLFGTQTGTAEGFAKAIAEEAKA
RYDKAKFRVVDMDDYAADDDEYEEKFKKETVIIFFLATYGDGEPTDNAARFYKWFTEGNE
GGEESFKNLQYGVFGLGNRQYEHFNKVAKVVDDMLAEKGGKRLVPVGLGDDDQCIEDDFT
AWKEELWPALDQLLRDGDDTTVATPYTASVLEYRVVIRDPLDATVDEKKWHNVNGHAVVD
AQHPVRGNVAVRRELHTPASDRSCTHLEFDISGTGVVYETGDHVGVYCENLSETVEEAEK
LLGLSPDTYFSIHTDDEDGKPLSGGSLPPPFPPCTLRTALTRYADVLSSPKKSALLALAA
HASDPSEAERLRHLASPTGKDEYAEWVIASQRSLLEVMAEFPSAKPPIGIFFAAVAPRLQ
PRYYSISSSPKMAPSRIHVTCALVHDKMPTGRIHRGVCSTWMKNSAPLDKSQDCSWAPIF
VRQSNFRLPADNKVPIIMIGPGTGLAPFRGFLQERLALKEEGAELGPSVLFFGCRNRQVD
YIYEDELNQFVNGGALSELIVAFSREGPTKEYVQHKMMEKASDIWNMISQEGAYIYVCGD
AKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMNGRYLRDVW
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattcaagttccatgaaattctcaccgttggatctgatgtctgccattatcaaa
ggcaagttagacccatccaacgtctcatctcaggtctctgcttccctaatgctcgaaaac
cgcgaattcgttatgcttttgacaacttccgttgccgttctcatcggttgcgtcgtcgtt
ttaatatggcgcagatccaacgctcaaaaatcaaagccaattgaagttcctaaacgaatc
atcgataaacttcccgaacttgatgttgacgacggtactaaaaaggttaccgtcttattt
ggtactcaaaccggtaccgctgaaggtttcgctaaggcgatagcggaagaggcaaaagcg
cgttacgacaaggctaagtttagagtagttgatatggatgattatgcggctgatgacgat
gagtacgaagagaaattcaaaaaggagacggtgattattttctttttagctacatatggc
gatggggagccaactgataatgcggcaaggttttataaatggtttacggagggaaatgag
ggaggtgaagaatcgtttaagaatcttcaatatggtgtgtttggacttgggaacagacag
tatgagcattttaacaaggtggcaaaggtggtagatgatatgcttgctgagaaaggtggt
aagcgtcttgtcccagtgggtctaggagatgatgatcaatgcatagaagatgactttact
gcatggaaagaagaactgtggccagccttggatcaattgctaagagatggggatgataca
actgtggccacaccttatactgcttctgttttggagtaccgggttgttattcgtgatcca
ctagatgcaactgttgacgaaaagaagtggcataatgtaaatggtcatgctgttgtggac
gctcagcatccagtcaggggtaatgtggctgtgcgaagggagcttcacactcctgcatca
gatcgttcttgcactcatttagaatttgacatttcaggcactggagttgtatatgaaaca
ggggaccatgttggtgtttactgtgagaatttatccgaaactgtggaagaggcagaaaag
ctactaggtttgtcacctgacacctatttctccatccataccgacgacgaagatgggaaa
ccacttagtggaggctccttaccacctcctttcccaccatgcactttaaggacagcactt
actagatatgcagatgttttgagttcaccaaaaaagtctgccttgcttgccttagctgct
catgcatctgatccatctgaagcggaaagactacgacatcttgcctcacctactggaaag
gatgaatatgcagagtgggtcattgcctctcaaagaagtctccttgaggtcatggctgaa
tttccatcagccaaacctccaattggtatattttttgcagccgttgctcctcgcctgcag
ccaagatactattcaatctcatcatctccaaaaatggctccatccagaattcatgttaca
tgtgccctagtgcatgataaaatgcccactggaaggattcatagaggagtgtgttcaaca
tggatgaagaattctgcaccattggacaaaagccaggattgcagttgggctcctatcttt
gttaggcagtccaatttcagactccctgctgataataaagtgcctataattatgataggt
cctggcactggcttggcacctttcagaggtttcttgcaggaaagattagctctgaaagaa
gaaggagctgaactgggcccttctgttttattctttggatgtaggaaccgtcaagtagac
tatatctatgaagacgaattgaaccaattcgttaatggtggcgcactttctgagctcatt
gttgccttctcacgagaggggcctacaaaagaatatgtccaacataagatgatggagaag
gcttcagatatttggaacatgatatctcaagagggagcttacatttatgtgtgtggtgat
gccaagggtatggctagggatgtacaccgcactctgcacacaattttacaagagcagggt
tctctggacagttctaaggctgagagcatggttaagaacctacaaatgaatggcagatat
ttgcgtgatgtatggtga

DBGET integrated database retrieval system