KEGG   Cicer arietinum (chickpea): 101498563Help
Entry
101498563         CDS       T02819                                 

Definition
(RefSeq) uncharacterized LOC101498563
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00790  Folate biosynthesis
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101498563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cam04147]
    101498563
Enzymes [BR:cam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     101498563
Exosome [BR:cam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101498563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 101498563
NCBI-ProteinID: XP_004512034
UniProt: A0A1S2YYQ4
Position
Ca8
AA seq 187 aa AA seqDB search
MRRVNAMNRILLLIRHPLSVSKPTLLPLPFFLQSNRTRLIMDSNNIQNNQLPVSSLTTTF
CTSHKDLSKKTCVPCNSKDLQPMTEDAARTLIPQVSEWNLVNEGGSLKLSRSWKVKSFNK
GLEFFRLIADLAEAEGHHPDLHLVGWNNVTIEIWTHSAGGLTENDFILAAKINELNVHSL
LRRKASD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagtgaatgcaatgaatcggattcttcttctcattcgccaccctctctctgtt
tccaaacccactcttcttccattaccattctttctccaatccaatcgaacacgattaata
atggattctaataatatacaaaacaatcaactcccagtttcgtcacttaccaccacattt
tgcacttcccacaaagatctatcaaagaagacttgtgtaccgtgtaattcgaaggatttg
caacccatgacagaggatgcagctcgtactcttattccacaggtttcggagtggaatttg
gtaaacgaaggtggttctttgaaactgagcaggtcatggaaagttaagtcttttaacaaa
ggattggagtttttcagattaatagctgatcttgctgaagctgaaggtcatcatcctgat
cttcaccttgttggctggaataatgttactatagagatttggactcattctgctggtggg
ctgacagagaatgacttcatacttgctgctaagatcaatgagcttaatgtgcatagctta
ctaagaaggaaagcttctgactga

DBGET integrated database retrieval system