KEGG   Cicer arietinum (chickpea): 101498663Help
Entry
101498663         CDS       T02819                                 

Definition
(RefSeq) glutamate dehydrogenase A-like
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00220  Arginine biosynthesis
cam00250  Alanine, aspartate and glutamate metabolism
cam00910  Nitrogen metabolism
cam01100  Metabolic pathways
cam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101498663
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101498663
   00220 Arginine biosynthesis
    101498663
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101498663
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101498663
Exosome [BR:cam04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101498663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N NAD_binding_7 HTH_8 AdoHcyase_NAD 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 101498663
NCBI-ProteinID: XP_004508961
UniProt: A0A1S2YRW7
Position
Ca7
AA seq 411 aa AA seqDB search
MNALAATNCNFQRAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCNPRDLSISELERL
TRVFTQKIHDLIGIQRDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
REAATGLGVVFATEAWLAENGKSIAENTFVIQGFGNVGTWAAKSLYERGGKVVVVSDITG
AIRNPNGIDIPALLKHKETNGNLTEFQGADVMDPNEVLVHECDVLIPCALGGVLNKENAA
DVKAKLIVEAANHPTDPEADEILAKKGVTILPDIYANAGGVTVSYFEWVQNIQGFMWDEE
KVNRELKKYMSKAFLDIKAMCKSNNCDLRMGAFTLGVNRVARATLLRGWEA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctctagcagccacaaactgcaattttcaacgtgctgctcgtattctaggcttg
gattccaagcttgagaagagtcttctcatacccttcagagaaatcaaagttgaatgtacg
atccccaaagatgatggaactctggtttcttatgtggggtttaggatccaacatgacaat
gctcgtggtcctatgaaaggagggattcgttatcaccctgaggttgaccctgatgaggtg
aatgctctagctcagctgatgacatggaagacagctgtagcagacatcccctacggagga
gcaaagggtggaattggctgcaacccaagggacctgagcatcagtgagttagaacgtcta
actcgggttttcacccaaaagattcatgatctcattggtattcagcgggatgttcctgcc
cctgatatgggaaccaatgctcagactatggcatggattctcgacgagtattcaaagttt
cacggtcattcaccagctgttgtgaccggaaagccaattgatcttggaggttctttggga
agggaggcagccacaggtctcggagttgtttttgcaactgaggcttggttagctgaaaat
gggaagtcaattgctgagaacacatttgtcattcagggctttggaaacgtgggaacctgg
gccgctaagtctctttatgagagaggtggtaaggttgttgttgtgagtgacatcactggt
gccatccgaaatcccaatggaatcgacatccctgcccttctgaaacacaaggaaaccaac
ggaaacttgaccgagttccaaggagcagatgtaatggatccaaatgaagtgcttgttcat
gaatgtgatgttcttatcccatgtgccttgggtggagtactgaacaaggaaaatgctgct
gatgtgaaagctaaacttatagttgaagctgcaaatcacccaactgaccctgaagcggat
gagattttggccaaaaaaggagtcactatattacctgatatttatgctaatgctggtgga
gttactgtgagctactttgaatgggttcagaacattcaaggtttcatgtgggatgaagaa
aaagtgaaccgtgagctgaagaagtacatgagcaaggctttcctagacatcaaagcaatg
tgcaaatccaacaattgtgacctgagaatgggagccttcactctgggagtgaaccgtgtt
gcccgcgctactcttttgagaggttgggaagcttaa

DBGET integrated database retrieval system