KEGG   Cicer arietinum (chickpea): 101499291Help
Entry
101499291         CDS       T02819                                 

Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00600  Sphingolipid metabolism
cam01100  Metabolic pathways
Module
cam_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101499291
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101499291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 101499291
NCBI-ProteinID: XP_004485708
UniProt: A0A1S2XC76
Position
Ca1
AA seq 489 aa AA seqDB search
MDLSVHQRPLFSDRVTVNGTVTPLALLADGRLWWSEGIQRCLSVEKEVIGFVTNGPCIKL
KTLVEARDGCCTTGAAGRLVRNDVVFKPSSEESHRLWCQKLREFIDSLGRPKRLLVFVNP
FGGKKSAVKILYEQVKPLLEDAQIELTIQETQHQLHAKEVARSVDITKHDGIVCVSGDGI
LVEVVNGLLQRDDWETAIKMPLGVVPAGTGNGMAKSLLDSVGDPCAVANAVLAIIRGHKR
QLDVATIAQGETRFFSILMLAWGLIADIDIESEKYRWMGSARLDFYALCRFFNMRQYNGS
VSFVPAPGFESYGESTSYPGKSTIKGNNSDPSEGEHFNLQTHCYQGPEVDLENLNWRVIT
GPFISVWLHNVPWGAEDTMAAPDAKFSDGYLDLIIMKNCPKLQLLSMMSELNNGGHVKSP
YVTYLKVKAFILEPGPRTKDQEKEGILDSDGEVLARGKGTYKCEQKSLMSYDKLQITVDK
GLATLFAPV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggatctatccgttcaccagcgtcctttattttcggaccgagtaacggtcaacggcacc
gtaacgccgctcgctcttctcgccgacggtagactctggtggtcggaagggatccaacgc
tgtctctccgtcgaaaaagaagtaatcggattcgtcactaatggaccctgcatcaaactc
aaaacactcgtcgaggctcgagacggttgctgcaccaccggtgccgctggaagactcgtt
cgtaacgacgtcgtttttaaaccctcgtcggaggaatcgcataggctctggtgtcagaag
cttcgcgaattcatcgattctctcggtcgacctaagaggttacttgtttttgtgaatccg
ttcggtgggaaaaaatctgctgtgaagattttgtatgaacaagtcaaacctcttcttgaa
gatgctcaaattgaactcactattcaagaaactcaacatcagctccacgccaaggaggtt
gctcgttcggtggatattacaaagcacgatggaattgtttgtgttagtggagatggaatt
ttggttgaggttgtaaatgggcttctacaaagagatgattgggaaacagcaataaagatg
ccccttggagtagttcctgcaggtacgggaaatggcatggcaaaatctctgcttgattca
gtcggtgatccttgtgcagtggccaatgcagttcttgccattatacgaggccataagcga
cagcttgatgtggctaccatcgcacaaggggaaaccagatttttcagtatattgatgctt
gcatggggtctaattgctgatattgacattgagtctgaaaagtatcggtggatgggaagt
gctcgtctagatttttatgctctctgtcgattcttcaatatgaggcaatacaatggatct
gtttcttttgtacctgcacctgggtttgagtcttacggggagtcaactagttaccctggc
aaatccactatcaaagggaacaacagcgatccaagtgaaggggaacattttaatttgcaa
acacattgttatcaaggacctgaagtagacttggaaaacctgaattggagagttataact
ggaccctttattagtgtctggcttcacaatgtaccttggggtgctgaggatacaatggca
gcacctgatgcaaagttctctgatggttatctagacctgatcatcatgaagaattgccca
aagttacaattgctgtcaatgatgtcagagttgaataatggaggacacgtgaaatctcca
tatgtcacgtacctgaaggtgaaagcttttatcttggaacctggtccccgcaccaaggac
caagagaaggaagggatcttagattctgatggtgaggttttggcaagagggaaaggaacc
tacaagtgtgagcagaagtctttgatgtcctatgataaattgcaaataacagtggataaa
ggtttagctacactttttgcccctgtataa

DBGET integrated database retrieval system