KEGG   Cicer arietinum (chickpea): 101499528Help
Entry
101499528         CDS       T02819                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 3A, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00630  Glyoxylate and dicarboxylate metabolism
cam00710  Carbon fixation in photosynthetic organisms
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
Module
cam_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cam_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cam_M00532  Photorespiration
cam_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101499528
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101499528
Enzymes [BR:cam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101499528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 101499528
NCBI-ProteinID: NP_001296613
UniProt: Q9ZP07
Position
Ca2
AA seq 181 aa AA seqDB search
MASSMISSSAVTTVKRASSVPSGAVAPFVGLKSMAGFPVRKVNNDITSIASNGGRVHCMQ
VWPPIGKKKFETLSYLPPLTEEQLLKEVEYLLRKGWVPCLEFELEKGFVYREHNNSPGYY
DGRYWTMWKLPLFGCTEAVQVLKELQEVVKAYPNAFVRIIGFDNVRQVQCISFIAHTPKE
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgatttcctcttcggcggtgaccaccgttaaacgcgcctcttcggtg
ccatccggcgcggtggctccatttgttggtctcaaatccatggctggtttcccagttaga
aaggtcaacaatgacatcacttccattgcaagcaatggtggaagagtacactgcatgcaa
gtgtggccaccaattggcaagaagaagtttgagactctctcataccttccaccattgact
gaagagcaattgctaaaggaagttgaataccttctaaggaagggatgggttccttgcttg
gaatttgagttggagaaaggatttgtgtaccgtgagcacaacaactcaccaggatactat
gatggaaggtactggacaatgtggaagcttccattgtttggttgcactgaggctgttcaa
gtgttgaaggaacttcaggaagttgtaaaggcttaccctaatgcttttgtccgcatcatt
ggatttgacaatgttcgccaagtgcaatgcattagtttcattgcacacacacctaaagag
ttctaa

DBGET integrated database retrieval system