KEGG   Cicer arietinum (chickpea): 101500116Help
Entry
101500116         CDS       T02819                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101500116
Enzymes [BR:cam01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101500116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 101500116
NCBI-ProteinID: XP_004500742
UniProt: A0A1S2Y7T0
Position
Ca5
AA seq 196 aa AA seqDB search
MQTQLPSSSYSSPIGNFQFSAPSKMSNPKVFFDMTVGGQPAGRIVMELYSDTTPLTADNF
RALCTGEKGTGRSGKPLHYKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFI
KTHTGPGVLSMANAGPGTNGSQFFICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSS
GKTSKPVVIADCGQLS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcaattgccatcatcttcttattcttctccaataggtaactttcagttctcc
gcgccttctaaaatgtctaaccctaaagttttcttcgacatgactgtcggaggccaaccc
gccggtcgtattgtcatggagctttactccgacactactcctctaaccgccgataatttc
cgtgcactctgcaccggcgagaaaggaaccggtcgcagcgggaagcctctccactacaaa
ggctcttccttccaccgcgttatccctaacttcatgtgtcaaggaggtgacttcaccgcc
ggaaacggaaccggcggagagtccatctacggggcgaaattcgccgacgagaatttcatc
aagacgcacaccggacctggtgtgctttcgatggcgaatgcgggtcccggtacgaacgga
tctcagtttttcatatgcacgacgaagacggagtggcttgatgggaagcacgtggttttt
ggtcaggtggttgagggaatggatgttgtgaaggagatcgagaaagtggggtccagttct
ggtaagacctcaaagccggtggtcattgctgactgcggccaactctcttaa

DBGET integrated database retrieval system