KEGG   Cicer arietinum (chickpea): 101500450Help
Entry
101500450         CDS       T02819                                 

Definition
(RefSeq) protein tipD-like
  KO
K17890  autophagy-related protein 16-1
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:cam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    101500450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cam04131]
    101500450
   03029 Mitochondrial biogenesis [BR:cam03029]
    101500450
Membrane trafficking [BR:cam04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    101500450
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    101500450
Mitochondrial biogenesis [BR:cam03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    101500450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 PQQ_2 Cytochrom_D1 Lebercilin zf-C4H2
Motif
Other DBs
NCBI-GeneID: 101500450
NCBI-ProteinID: XP_004501842
UniProt: A0A1S2YAA5
Position
Ca5
AA seq 511 aa AA seqDB search
MANSCKSKEEIANGAIKRALKALRKRHLNEEGAHAAALSRPIVSQDSEWKEKAESLELEL
QQCYKAQSRISEQLVVEIAESRTLKALVQEKETAITDLQKELTEVRDECLQLKKDLEDKI
KALELVLSENTELKTQLEQMAIRAKNAETENKTLVDRMMLEKMKDAEQLNEANQLYDDMI
KQLKASGLEKLARQHIDGIVRRSEEGTDVFLESNIPSTCKYRLQAHEGGCASILFQYNSN
KLITGGQDRTVKVWDADSGSLISKLYGCLGSVLDLTITNDNRSVIAASSSNNLYAWDLNS
GRVHHTLTGHTDKVCTVDVSKVSSRHVISAAYDRTIKVWDLHKGYCINTIIFHSNCNALC
FSMDGQTIFSGHVDGNLRLWDIKTGKLLSEVAAHSLAVTSITLSRNGNVVLTSGRDNLHN
LFDVRSLEVTATLKATGNRVASNWSRSCISPDDNNVAAGSSDGSLCVWSASKGDILGTLK
EHTSSILSCAWSGLGRPLASADKNGVVCIWA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcttgcaagtcaaaggaagaaattgcaaacggagctatcaaacgcgctttg
aaggctctgcggaagcggcatttgaacgaagaaggagctcatgctgctgctctttctaga
cctattgtttctcaggactctgaatggaaggagaaagcagagagtctggaactggaactt
cagcaatgctacaaagctcagtcccgaatatccgagcaactcgttgtagaaatagctgaa
tccagaactttgaaagctttggttcaagagaaagaaactgctatcactgatttgcagaag
gaattgactgaagtgagagatgagtgcttgcaattgaaaaaggacttggaagacaaaatt
aaggctcttgaactcgttctgagtgagaatacagaacttaaaacacaattggagcaaatg
gctataagagccaagaatgctgaaactgaaaataagacattggtcgatcgcatgatgtta
gaaaaaatgaaggacgctgaacaattaaatgaggcaaaccaactgtatgatgacatgatc
aagcagctaaaggccagtggtttagaaaaacttgcaaggcagcatatagacggtattgtt
cgccgaagtgaagaaggtactgatgtctttttagagtcaaatatcccttccacatgcaaa
tacaggctccaagcacatgagggtggttgtgcttccatattgttccagtacaattctaat
aaattgattactgggggacaggatcgaacagttaaagtgtgggatgcagattcaggatcc
ttaatttccaaactttatggatgtcttggctctgtattagatctcacaataaccaacgac
aatagatccgttattgctgctagcagctcaaacaacttgtatgcgtgggatctcaactcg
ggtcgagttcatcatacccttaccggtcacacagataaagtctgcactgtcgatgtgagc
aaagtttccagccgccacgttatcagtgcagcttacgatcgcactataaaagtttgggac
ttgcataaaggttattgcattaacacaataattttccacagtaactgcaatgctctttgc
ttcagcatggatggacagaccatattttctggacatgttgatggaaatcttcgattatgg
gatattaaaactggaaaactacttagcgaggttgcagcacactcacttgccgtcacatca
ataactctttctcggaatggaaatgttgtattaaccagtggaagagacaatttgcacaat
ttgttcgatgtgcgatctctagaagttactgccacactaaaagccaccggaaatagagtg
gcctctaattggagtcgctcgtgtattagtccggatgataataatgttgctgctggatca
tctgatggatctttgtgtgtttggtcagcatctaaaggtgatatactcggcactttgaag
gaacatacttcttctattctttcttgtgcatggagtgggcttggaagacccttagcttca
gctgacaagaatggagttgtttgtatatgggcctaa

DBGET integrated database retrieval system