KEGG   Cicer arietinum (chickpea): 101500539Help
Entry
101500539         CDS       T02819                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00052  Galactose metabolism
cam00500  Starch and sucrose metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101500539
   00500 Starch and sucrose metabolism
    101500539
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101500539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 101500539
NCBI-ProteinID: XP_004498875
UniProt: A0A1S2Y5K2
Position
Ca4
AA seq 582 aa AA seqDB search
MKNFAASLLLVIISFVIISFLLNNGIKASTHSNSDDHIKYMLPDEQPYRTSYHFQPPQYW
MNDPNAPMYYKGVYHLFYQHNPYAATFGDRIIWAHSVSYDLISWIHLNHAIEPSEPYDIN
SCWSGSATILPGEKPAILYTGIDKNKHQVQNLAFPKNLSDPFLREWEKHPQNPVMTSPSG
VEKDNFRDPSTAWHGNDGKWRVIIGAQNGDEGKTILYQSDDFLNWTVNPNPFFATDDTGV
CECPEFFPVYINSTNGVDTSVENQSVRHVLKISYIRIQHDYYFVGKYVSEKEKFTPDVEF
KGTSSDLRFDYGKFYASKSFFDYAKNRRILWGWVNESDTTQDDIEKGWAGLQTIPRQVWL
DKSGKRLMQWPIEELENLRDKQISITEQKLESGSTLEVLGITASQVDVEVLFELPELESG
EWLDPSEVDPQLLCSKQYESRSGKIGPFGLLALASKDLTEQTAVSFQIYRAPNRYICLMC
SDQSRSSLRQDLDKTTYGTIFDIDANLKTISLRSLIDKSIIESFGDGGRACITSRVYPSL
AIEKDAHLYVFNNGSQSVVISKLNAWSMKQAEFSHEENISCA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttgcagcatcactattacttgtgataatttcttttgtgataatttctttt
ctgttaaacaatggaattaaggcatcaacacatagtaacagtgatgatcatatcaagtac
atgctacctgatgaacaaccttacagaacttcttatcattttcagcccccacaatattgg
atgaacgatccaaatgcccctatgtactacaaaggtgtttaccaccttttctaccaacat
aatccttatgcagcaacatttggtgataggattatatgggctcattcagtatcctatgat
ctcataagttggattcatctaaatcatgctattgagccaagtgagccttatgacatcaac
agttgttggtcaggctcagccactatactcccaggtgaaaaacctgctattttgtacaca
ggaattgataaaaataaacatcaagttcagaacttagcttttccaaagaatctatcagac
cctttcttaagggaatgggaaaaacatcctcaaaaccctgtcatgacttcacctagtgga
gttgaaaaggataatttcagagacccttcaactgcatggcatggaaatgatggaaaatgg
agggtaatcattggtgctcaaaatggtgatgaagggaagactatactctaccaaagtgat
gattttcttaattggactgtgaatccaaaccctttttttgcaacagatgacactggagtt
tgtgaatgtcctgagttttttcctgtttatataaatagcacaaatggggtggatacatct
gtggaaaatcaaagtgttagacatgttttgaagataagctatataaggatacagcatgac
tactattttgttggtaaatatgtttctgagaaggaaaagtttactcctgatgtagaattt
aaaggaactagttcagatttaaggtttgactatggtaaattttatgcctcaaagtcattt
tttgactatgctaagaataggaggatattgtggggatgggtgaatgagtctgacactaca
caagatgacattgagaaaggatgggctggtctacagacaattccaaggcaagtttggctt
gataaaagtgggaagagattgatgcagtggccaattgaagagctagaaaatctaagagac
aaacaaatcagtattacagaacagaaacttgaaagtggatcaactcttgaagtcttaggt
atcactgcatcacaggttgatgtagaagtgttgtttgagctacctgaactagaaagtggt
gagtggttagatccaagtgaagttgatcctcaactactatgtagcaaacaatatgaatca
agaagtggcaaaataggaccatttggtttgttagctttagcttcaaaggatctcacagag
caaactgcagtgtcttttcaaatatatagagctcccaatagatatatatgtctaatgtgc
agtgaccagagcaggtcttcgttgcgtcaggaccttgataaaaccacatatggaactatc
tttgacatagatgccaatctcaaaacaatttcactaagaagcttgattgacaagtccatt
attgagagttttggtgatggagggagagcttgcataacaagtagagtttatccttcattg
gctatagaaaaagatgcacatctttatgtgttcaacaatggaagccagagtgtggttatc
tcaaaacttaatgcttggagtatgaagcaagcagagtttagccatgaggaaaatataagc
tgtgcctaa

DBGET integrated database retrieval system