KEGG   Cicer arietinum (chickpea): 101501378Help
Entry
101501378         CDS       T02819                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00052  Galactose metabolism
cam00500  Starch and sucrose metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101501378
   00500 Starch and sucrose metabolism
    101501378
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101501378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 101501378
NCBI-ProteinID: XP_004498878
UniProt: A0A1S2Y3U5
Position
Ca4
AA seq 552 aa AA seqDB search
MENITKDASLNSINNDQPYRTWYHFQPPKNWMNDPNGPMYYKGVYHFFYQHNPDGATFGK
KMVWGHSISYDLINWTHLKHAIRPDSIGDINSCFSGSATILPGEKPVILYTGIDGKKHQV
QNLAFPKNLLDPFLREWEKHPQNPVMTPPSEVEEDNFRDPSTAWQGKDGKWRVVIGAQNG
DEGKAILYKSDDFFDWKVDPNPFFATDGTGVCECPDFFPVYVNSTNGVDTSVENSSVRHV
FKISYLRRHHDYYFIGSYVSDSDKEKFVPDVKYTGSWKELRFDYGNFYASKSFFDYAKNR
RILWGWVEENDSRQDSIERGWAGLQTIPRKFWLDKDGKQLMQWPIEELEKLRDNQINITG
ETLLGGSTLEVQGITASQADVEVLFELPDLQNAELIDPSEVDPQILCSEQYASRNGIIGP
FGLLALASKDQTEKTAIFFRIYRTLDKYVCLMCSDQSRSSLRQETEKTTYATIFDIDPNL
KTISLRTLIDRSIIESFGDGGKVCITSRVYPSLAIEKDAHLYVFNNGSQSVVISKLNAWS
MKQAEFGMENII
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggagaacattacaaaagatgcatccctaaacagcatcaataatgatcagccatataga
acttggtatcactttcagcccccaaaaaattggatgaatgatcctaatggaccaatgtac
tataaaggagtttaccatttcttctaccaacataacccagatggagcaacctttggtaaa
aaaatggtatggggtcattctatatcctatgatctcatcaattggacacatctaaagcat
gctattagaccagattctattggtgacataaacagttgcttctcaggctcagcaactata
ctcccaggtgaaaaacctgttatattgtacacaggaattgatggaaaaaaacaccaagtt
caaaacttagcttttccaaagaatctattagaccctttcttaagagaatgggaaaaacat
cctcaaaaccctgtcatgactccacctagtgaagttgaagaggataattttagagaccct
tcaactgcatggcaaggaaaagatggtaaatggagagtagtaattggtgctcaaaatggt
gatgaaggaaaagctattctatacaaaagtgatgatttttttgattggaaagttgaccct
aatcctttttttgcaacagatggtactggagtttgtgaatgtcctgatttttttcctgtt
tatgttaatagcacaaatggggtggatacatctgtggaaaattcaagtgttagacatgtt
tttaagataagttatttacgtagacatcatgattactattttattgggagttatgtgtct
gattctgataaggaaaagtttgttcctgatgtaaaatatactggaagttggaaggaatta
agatttgattatggaaatttttatgcttcaaagtcattttttgattatgctaagaatagg
agaatattatggggttgggtggaagaaaatgactctagacaagatagcattgaaagagga
tgggctggtttacagacaattccaaggaagttttggcttgataaagatgggaagcaatta
atgcaatggccaattgaagagttagaaaaactacgtgacaatcaaatcaatatcacagga
gagacactcctaggtggatcaacccttgaagtacaaggtatcactgcatctcaggctgat
gtggaagtcttgtttgagctacctgatctacaaaatgctgagttgatagatccaagtgaa
gttgatcctcaaatactttgcagtgaacaatatgcttcaagaaatggcataatagggcca
tttggtttgttagctttagcttcaaaggatcagacagagaagactgcaatatttttcagg
atatacagaacacttgataaatatgtatgcttgatgtgcagtgaccagagcaggtcgtca
ttgcggcaggagactgaaaaaaccacatatgcaactatctttgacatagatcctaatctg
aaaacaatttcacttagaactttgattgaccggtccattattgagagttttggtgatgga
gggaaggtttgcataacaagtagagtttatccctcattggctatagagaaagatgcacat
ctctatgtattcaacaatggaagccagagtgtagttatctcaaaactaaatgcttggagt
atgaagcaagcagagtttggcatggaaaatataatatag

DBGET integrated database retrieval system