KEGG   Cicer arietinum (chickpea): 101502106Help
Entry
101502106         CDS       T02819                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member H1-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00010  Glycolysis / Gluconeogenesis
cam00053  Ascorbate and aldarate metabolism
cam00071  Fatty acid degradation
cam00280  Valine, leucine and isoleucine degradation
cam00310  Lysine degradation
cam00330  Arginine and proline metabolism
cam00340  Histidine metabolism
cam00380  Tryptophan metabolism
cam00410  beta-Alanine metabolism
cam00561  Glycerolipid metabolism
cam00620  Pyruvate metabolism
cam00903  Limonene and pinene degradation
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101502106
   00053 Ascorbate and aldarate metabolism
    101502106
   00620 Pyruvate metabolism
    101502106
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101502106
   00561 Glycerolipid metabolism
    101502106
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101502106
   00310 Lysine degradation
    101502106
   00330 Arginine and proline metabolism
    101502106
   00340 Histidine metabolism
    101502106
   00380 Tryptophan metabolism
    101502106
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101502106
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    101502106
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101502106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101502106
NCBI-ProteinID: XP_004514084
UniProt: A0A1S2Z2Y5
Position
Un
AA seq 134 aa AA seqDB search
MNYNFALCLEQVNKLEESFNVINSRTKPRAAYLFTKDNKFKEQFVKKVSVGGLLINDIAL
HLVVYNLPFGGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPPYTDRKQKCMK
ALVAGDVPDVQFWL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaattataattttgctttgtgcctggaacaggtgaataagctggaagaaagcttcaat
gtgattaactcgagaacaaagccacgtgcagcatatttatttacaaaggacaataagttc
aaggaacaatttgtaaagaaagtttctgttggtggtttgcttatcaatgacattgcctta
catcttgtggtttataatttgccatttgggggagttggagacagtggaatgggtgcatac
catggaaaattctcctttcatgcttttactcacagaaaggcagtactttatcgcggtttt
acaggcgattcatctttaaggtacccaccttacacggatagaaagcagaaatgtatgaag
gctctagttgctggtgatgttcccgatgtgcaattttggttgtaa

DBGET integrated database retrieval system