KEGG   Cicer arietinum (chickpea): 101504789Help
Entry
101504789         CDS       T02819                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00052  Galactose metabolism
cam00500  Starch and sucrose metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101504789
   00500 Starch and sucrose metabolism
    101504789
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101504789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 101504789
NCBI-ProteinID: XP_004515311
UniProt: A0A1S2Z589
Position
Un
AA seq 603 aa AA seqDB search
MLSLQQVLSINRCLQVTSFLSHSYKRLHMGTYWLLAMFSFFLFYGVAHIEAFHQTHSLNQ
TYKPSFHFQPHKNWMNDPNGPMRYKGLYHMFYQHNPKGAIWSNNSIVWGHSISKDLVNWL
SLQHALIPSESYDINGCWSGSSTLLPNDKPKILYTGIDINQHQTQNLAIPKNVSDPLLRE
WIKSPNNPLMEPNNVNKINATSFRDPTTAWIGHHDGFWRVLIGSQKKDKGILILFKSKDF
FNWIQDKNPFYSAKNTGMWECPDFFPVLINGSIGLDISINNGYGIRHVVKVSLIDVSHDY
YFIGTYDTIKDVFVPDKGFDKINNELSLVLRYDYGKFYASKTFYDGEKKRRVLWGWINES
SIQEDDVKKGWSGIQAIPRTLWLHKSGKQLIQWPIVEIEKLRSNHVNLHSKVLKGGKMLE
IFGVTAAQADVEISFEVKELEKAQVLDPSWKLDPQHLCKENGSKVKGVVGLGPFGLLVLA
SKDMKEYTTIFFKVFRGNKKHVVLMCCDTRRSSLNHNNDLANYGAFVDVDPINEELSIRS
LIDHSVVESFGAQGKACITTRVYPTLAINDKAHLHVFNNGTIDVKIKKLNAWSMKKAKIN
EMH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccttacaacaagttctatctataaataggtgcttacaagtcactagtttcctt
agtcattcctacaaacgcctccacatgggcacttattggttgttggctatgttttccttc
tttcttttctatggtgttgcccatattgaagctttccatcaaactcattctttgaaccaa
acatataaaccttcttttcacttccaacctcacaagaattggatgaatgaccctaatggc
cctatgagatacaagggactataccatatgttctaccaacacaatccaaaaggagcaata
tggagcaacaatagtattgtttggggccattctatttcaaaggatctagtgaattggtta
tcattacaacatgctcttattccaagtgaatcatatgatatcaatggttgttggtcaggt
tcatccacacttctccctaatgacaaaccaaaaatcttatacacaggaattgacattaat
caacaccaaactcaaaatttggccatacccaaaaatgtgtctgacccattacttagggaa
tggataaaatcacctaataaccctttaatggaaccaaataatgttaacaaaattaatgca
acttcatttagagaccctaccactgcttggattggtcatcatgatggattttggagagta
cttattggaagccaaaaaaaggataaggggattttaattttatttaaaagtaaagatttt
tttaattggattcaagataaaaatcctttttattcagctaaaaatactggaatgtgggag
tgtcctgattttttccctgttttgattaatggttcaattggacttgatatatcaattaat
aatggttatggtattaggcatgtggtcaaggttagtttaattgatgtgtcacatgattat
tattttattggtacttatgacactattaaggatgtgtttgttcctgataagggatttgac
aaaattaataatgagttatcattggtactaagatatgattatggaaaattttatgcatct
aaaacattttatgatggtgaaaaaaagagaagggtcttatggggttggattaatgaatct
tcaattcaagaggatgatgttaaaaaaggatggtctggaattcaggcaattcctaggact
ctttggcttcataaatctgggaagcaattgattcaatggcctatagttgaaattgaaaaa
ctacgtagcaaccatgttaacttgcactctaaagtgttaaagggaggaaaaatgcttgag
atttttggtgtgacagctgcacaggctgatgttgaaatttcatttgaagtgaaagagctt
gaaaaggcacaagtcttagaccctagttggaaattggaccctcaacatctatgtaaggaa
aatggttcaaaagtaaaaggtgtagtaggattgggaccatttggtttactagttttggct
tcaaaggacatgaaagaatacacaacaattttctttaaggtatttagaggtaacaaaaaa
catgtggtgctcatgtgttgtgacacaagaaggtcttctttgaatcacaataatgacttg
gccaattatggagcttttgtggatgtagaccctattaatgaggagttgtcaataagaagt
ttgatagatcactctgtggtggagagttttggggcacaaggaaaagcatgcatcacaaca
agagtttatccaactttggcaatcaatgataaagcacaccttcatgtgttcaataatgga
acaattgatgttaaaatcaagaagttaaatgcttggagcatgaaaaaagcaaagattaat
gaaatgcattag

DBGET integrated database retrieval system