KEGG   Cicer arietinum (chickpea): 101505549Help
Entry
101505549         CDS       T02819                                 

Definition
(RefSeq) vacuolar-processing enzyme gamma-isozyme-like
  KO
K01369  legumain [EC:3.4.22.34]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cam01002]
    101505549
Enzymes [BR:cam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     101505549
Peptidases and inhibitors [BR:cam01002]
 Cysteine peptidases
  Family C13: legumain family
   101505549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 101505549
NCBI-ProteinID: XP_004499587
UniProt: A0A1S2Y712
Position
Ca5
AA seq 470 aa AA seqDB search
MDRRMRFWDVALIVMVCMSVTVTKSNGARPLNNQLQEGTGVKWAFLVAGSRGYGNYRHQA
DVCHAYQVLKSGGLKDENIIVMMYDDIADNVENPFRGTIINQPDGPDVYQGVPKDYTGTD
ANMFNFYAVLRGDKSATDGGSGKVLSSKPEDTVFIFIVSHGNKGIMGLPDDNIIYADMLV
DSLKINYKKMVIYIESCKAGSMLEGLLQDDVNIYATTSSRADEDSAAFYCPRGIMPPSPK
YTTCLGDLYSIAWLEYSDQYDRANKTLLDQYDVTWFRTLFTGEEYSAHVMPYGNITMHDD
LLETYFGRAKPIGANDNYHFNRTTTHEHSNKRFNTTTRLVSQQDAHLNYLKLKLEKAPDG
SLDKSKAQIELDDEISHRKHDDQSVYLIWKLLFGEDTTSTMMANLRSAGQPLVDDWDCLR
MLKNTYEHHCGVLSHYGWKYMQAFANMCNNGISKKQMIAAASQVCPKKNS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaaggatgaggttttgggatgttgcactaatagtaatggtatgcatgagtgta
acagtgacaaagtcaaacggtgcgcgtcctttgaacaaccaacttcaagaagggacaggg
gtaaaatgggctttcctagttgctggttctagaggttatggaaattataggcaccaagct
gatgtatgtcatgcctatcaagtattaaaaagtgggggtcttaaagatgaaaatatcatt
gttatgatgtatgatgatatcgccgataatgtagaaaatccattccgtggcactataatt
aatcaaccagatgggccagatgtttatcagggggttccaaaggattatacaggaacggat
gcaaatatgttcaatttttacgcagtgcttagaggcgacaaaagtgctactgatggaggt
agcggtaaggtactcagtagtaagccagaagataccgtattcattttcattgttagtcat
ggtaacaaagggataatgggattgccagatgacaacataatatatgccgacatgctcgta
gattcattgaaaatcaattacaaaaaaatggtgatatacatagaatcatgtaaggctggg
agcatgttggaagggcttcttcaagatgatgtaaatatttatgcaaccacatcttccaga
gcagatgaggatagcgctgcattttactgtccacgtggaataatgcctccatcgcctaag
tatacaacttgtttgggtgatttgtacagtattgcttggttggaatacagtgaccaatat
gatagggcaaacaaaactttgcttgaccaatatgatgttacgtggtttagaacacttttt
actggtgaagagtatagcgctcacgtgatgccatatggaaatataactatgcacgatgat
ttactagaaacatattttggacgtgctaaaccaattggagctaatgataactaccatttc
aatagaactacaactcatgagcattccaataaacgatttaatacgacaacaagattggtc
agccaacaagatgcacatttaaattatctgaagcttaagttggaaaaggcaccagatggt
tccctggataagtcaaaagctcaaattgagttagatgacgaaatttcccatagaaaacat
gatgaccagagtgtatatctcatatggaaacttttgtttggagaagacacaacctctact
atgatggcaaatcttcgttcagccggtcaacctcttgtcgatgattgggattgtcttaga
atgcttaaaaatacatatgaacatcattgtggtgtcttatcacattatggatggaaatac
atgcaagcctttgctaacatgtgcaataatggcatttccaagaagcaaatgattgcagca
gcatctcaagtttgtcctaagaaaaacagttaa

DBGET integrated database retrieval system