KEGG   Cicer arietinum (chickpea): 101506261Help
Entry
101506261         CDS       T02819                                 

Definition
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00900  Terpenoid backbone biosynthesis
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Module
cam_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101506261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cam01006]
    101506261
Enzymes [BR:cam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     101506261
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     101506261
    2.5.1.29  geranylgeranyl diphosphate synthase
     101506261
Prenyltransferases [BR:cam01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   101506261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 101506261
NCBI-ProteinID: XP_004491403
UniProt: A0A1S2XNF1
Position
Ca2
AA seq 302 aa AA seqDB search
MVIKTSQLANVKSTVHFSCISKSNQYRSHLPLKPTTVRMSMTQTHHTHPYWASLQADIEA
HLKQSITIKEPLVVFEPMHHLVFNAPKTTVPALCLAACELVGGQRNQAISAASALLLMEA
ATYTHEHLLLSDRPKPKPVITHAYGPNVELLTGDGIVPFGFELLARSNGGENSERILRVM
VEISRAVGSGGVIDAQYRKTMDSGSDGDEMCHVEGIRRVVEKYEGELHACGAVCGGVLGG
GSEEEIERLRNYGFYVGMIQGMLQRGFKDDNKEVEETRKFALHELQFFKDREVDAISTFL
NI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggttattaaaacttcccaactcgccaatgtcaaatccaccgttcatttttcatgcata
tcaaaatcaaaccaataccgttcccacttaccccttaagcccacaaccgtaagaatgagt
atgactcaaactcatcacacgcatccttattgggcttcgttgcaggccgacattgaagcc
catctcaaacaatcaattaccatcaaagaacctctagtggtttttgagcccatgcatcat
ctcgtattcaacgccccaaaaaccaccgtgccggctttatgcctcgccgcatgcgagctt
gtcggcggtcaacgcaaccaagccatatccgccgcgtcagccttgctgctaatggaagca
gctacttatactcacgagcatcttctactttcagacaggcccaagcccaagcccgtgatc
actcatgcttacgggcctaatgttgagcttctaaccggggatggtattgttccatttggt
tttgaattgttagcgagatccaacggtggagaaaattcggagcggatcttgcgcgtgatg
gttgagatctcgcgcgctgtgggttcaggaggggtgatagatgcgcagtataggaaaact
atggatagtggatctgacggtgatgagatgtgccacgtggaaggtattaggcgcgtggtg
gagaaatacgaaggtgagttgcacgcgtgtggggctgtatgtggaggtgtattgggaggg
ggaagtgaagaggaaattgagagattaaggaattatgggttttatgttgggatgattcaa
ggaatgttacaaaggggattcaaagacgataataaagaagtggaagagacaagaaaattt
gcactccatgaattgcagtttttcaaggatagagaggttgatgcaatttctacttttctg
aatatttaa

DBGET integrated database retrieval system