KEGG   Cicer arietinum (chickpea): 101506305Help
Entry
101506305         CDS       T02819                                 

Definition
(RefSeq) vacuolar-processing enzyme-like
  KO
K01369  legumain [EC:3.4.22.34]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cam01002]
    101506305
Enzymes [BR:cam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     101506305
Peptidases and inhibitors [BR:cam01002]
 Cysteine peptidases
  Family C13: legumain family
   101506305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 101506305
NCBI-ProteinID: XP_004517111
UniProt: A0A1S2Z8T7
Position
Un
AA seq 375 aa AA seqDB search
MEQRMRFWVITLIVIVCMTITMTKSKGQDNGVKWAFLIAGSKGYVNYRHQADVCHAYQVL
KSGGLKDENIIVMMNDDIAYNFQNPYPGYIPNRPDGPNVYYNVPRDYTGYEATLRNFYSI
LRGDKKAIRRGSGKVLDTKPEDTIFIFFSGHGNTGILELPDEKVIYADKLVDTLKMKTSY
KKMVIYLESCHAGSMFQGLLPRDSKIYVTTASNPYENSFAFYCPHEKSPPSPAYTVCLGD
LYSISWLEDSEQIDRKTETLDEQYLKVWSRTYYTYDDQFSHVMRYGNYVNMGNYILDTYQ
GAGQSPENDNYHFNATPTHEHSYKRFNTTTGLVSQQDALLHYLKLKLEKASSVDKSKAQT
ELDDEISRRKHEDQS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaagaatgaggttttgggttattacactaatagtaatagtatgcatgactata
acaatgacaaagtcaaagggtcaagataatggggtaaaatgggctttcctaattgctggt
tccaaaggttatgtaaattataggcaccaagctgatgtatgtcatgcataccaagtatta
aaaagtggtggtcttaaagatgaaaatatcattgttatgatgaatgatgatattgcttat
aattttcaaaatccataccccggttatatacctaatagacccgacggtccaaatgtttat
tataatgttcccagggattatacaggatacgaagcaactctaagaaatttttactcaatc
cttagaggagacaaaaaggctattaggagaggtagtggtaaggtgctggatactaagcca
gaagatactattttcattttcttttctggccatggtaacactggcatactagaactgcca
gatgagaaagttatatatgccgacaaattagtagatacattaaaaatgaaaaccagttac
aagaaaatggtgatatacttagaatcatgtcacgctgggagcatgtttcaagggcttctt
ccacgtgattcgaagatttatgtaaccacagcttccaatccatatgagaatagttttgca
ttttactgtccacatgagaaaagtcccccatctcctgcttatacagtttgtttgggtgat
ttgtacagcatttcttggcttgaagatagtgaacaaattgatagaaaaaccgaaactttg
gatgaacaatatcttaaagtttggtccagaacatattatacttatgacgatcaattttct
catgtcatgcgatatggaaattatgtgaatatgggcaactatatactagatacatatcaa
ggtgctggacaatcaccagagaatgataactaccatttcaatgctactccaactcatgag
cactcctataaacgatttaatacgacaacaggattggttagccaacaagatgctctttta
cattatctgaagcttaagttggaaaaggcatcatctgtggataagtcaaaagctcaaact
gaattagatgatgaaatttcccgtagaaaacatgaggaccagagt

DBGET integrated database retrieval system